KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_01010Help
Entry
SCATT_01010       CDS       T02095                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:scy00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:scy00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(102824..103999)
Genome map
AA seq 391 aa AA seqDB search
MTDELTPTPEDRFSFGLWTVGWAGRDPFGDATRPPLDPVEAVHRLAALGAHGVTFHDDDL
FGFDATDSRREAILKRFRQALDATGLKVPMATTNLFTHPVFKDGAFTANDRDVRRFALRK
TLRNIDLAVELGAEVYVAWGGREGAESGAAKDVPAALDRLKEAFDLLTAYVHEQRYPLRF
AVEPKPNEPRGDILLPTVGHALAFIERLEHPELVGVNPEVGHEQMAGLNVTHGVAQALWS
GKLFHIDLNGQSGVKYDQDLRFGAGDLRQAFWLVDLLESAGYRGSRHFDFKPPRTEDPDG
VWDSAAGCMRNYLALKARSAAFRADPRVAEALRAARLDDLARPTLAPGETVTTLLADRSA
YEEFDVAAAAERGMAFERLDQLAMDHLLGIA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgaactgacccccacccccgaggaccggttctccttcggcctgtggaccgtc
ggctgggccggccgcgacccgttcggcgacgccacccggcccccgctcgacccggtcgag
gccgtccaccgcctcgccgccctcggcgcccacggggtcaccttccacgacgacgacctc
ttcggcttcgacgccaccgacagccgccgcgaggccatcctcaagcgcttccggcaggca
ctggacgccaccgggctcaaggtgccgatggccaccaccaacctgttcacccacccggtc
ttcaaggacggcgccttcaccgccaacgaccgcgacgtgcgccgcttcgcgctgcgcaag
accctgcgcaacatcgacctggccgtcgaactcggcgccgaggtctacgtcgcctggggc
ggccgggagggcgccgaatcgggcgccgccaaggacgtacccgccgccctcgaccgcctc
aaggaagccttcgacctgctcaccgcctacgtccacgaacagcgctacccgctgcgcttc
gccgtcgagcccaagcccaacgaaccgcgcggcgacatcctgctgcccaccgtcggccac
gccctggccttcatcgaacggctggagcaccccgaactcgtcggcgtcaaccccgaggtg
ggccacgagcagatggccgggctcaacgtcacccacggcgtcgcgcaggcgctgtggtcc
ggcaagctcttccacatcgacctcaacggccagtcgggcgtcaagtacgaccaggacctg
cgtttcggcgcgggcgacctccgccaggcgttctggctggtcgacctgttggaatccgcc
gggtaccgcggctcgcgccacttcgacttcaagccgccgcgcaccgaggaccccgacggg
gtgtgggactccgcggccggctgcatgcgcaactacctcgcgctgaaggccaggtccgcc
gccttccgcgccgacccccgggttgccgaggcgctgcgcgccgcccggctggacgacctg
gcccggcccaccctggcccccggcgagacggtgacgacgctgctcgccgaccgatccgcc
tacgaggagttcgacgtggccgccgccgcggaacgcgggatggccttcgaacgcctcgac
cagctcgccatggaccacctgctcggcatcgcctga

DBGET integrated database retrieval system