KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_02780Help
Entry
SCATT_02780       CDS       T02095                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00625  Chloroalkane and chloroalkene degradation
scy00680  Methane metabolism
scy01100  Metabolic pathways
scy01120  Microbial metabolism in diverse environments
scy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SCATT_02780
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCATT_02780
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     SCATT_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C HI0933_like ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AEW92649
UniProt: F8JNR9
Position
complement(323026..324192)
Genome map
AA seq 388 aa AA seqDB search
MVYEGTRRVGVHEVEDAVVEEPTDVVVRITSSAMCGTDLHMYDGRTGARPGLVLGHEPLG
VVEKAGPAVTMVAPGDRVVMPTHLYCGVCPTCARGLTAACTRVRPGGFGAAYGYAGMGPY
RGAQAELLRVPYADANCMPLPGSPGDAYEDAFVLLADAFVTGWHACELAGTGPGDSVAVF
GAGAVGLLAAHSAVLRGAAEVYVVDHLPERLAVAADFGALPVDTRDGDPGEQIRSLRNSG
GGMPPGEAGLDGVTCGIDAVGFQARSRADLDQEDPRQVIDDLAAIVNPTGRIGVAGVFAA
HDAHPAPHGHADGTLQVPWAVLFDKGVRVGFGRTHDRRYTRLLRDLILTGRAEPQRVVTH
HGPLEDAPAFYTAFDRREDGVIKAVLHP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggtctacgaaggcacccggcgggtcggcgtgcacgaggtcgaggacgccgtcgtcgag
gaacccaccgacgtggtcgtccgcatcacctccagcgcgatgtgcggcaccgacctgcac
atgtacgacggccgcaccggcgcccgccccggactggtgctcggccacgaaccgctgggc
gtggtggagaaggccggacccgcggtgaccatggtcgcccccggcgaccgcgtggtgatg
cccacccatctgtactgcggcgtctgccccacctgcgcccgcggcctgaccgccgcctgc
acccgggtacgccccggcggcttcggcgccgcctacggctacgccgggatgggcccctac
cgcggcgcccaggccgaactgctgcgggtgccctacgccgacgccaactgcatgccactg
cccggctccccgggcgacgcctacgaggacgccttcgtgctgctcgccgacgccttcgtc
accggctggcacgcctgcgaactggccggcaccggacccggcgacagcgtggccgtcttc
ggcgccggcgcggtggggctgctggccgcccactccgcggtgctgcgcggcgccgccgag
gtgtacgtcgtcgaccacctgcccgaacgcctcgcggtcgccgcggacttcggcgcgctg
ccggtcgacacccgggacggcgaccccggcgagcagatccgctcgctgcgcaactccggc
ggcggcatgccccccggcgaggccggactcgacggggtgacctgcggcatcgacgccgtc
ggcttccaggcccgcagccgcgccgacctcgaccaggaggacccccgccaggtgatcgac
gacctggccgccatcgtcaaccccaccggccggatcggcgtcgccggggtcttcgccgcc
cacgacgcccacccggcgccgcacggccacgccgacggcacgctccaggtgccgtgggcc
gtcctgttcgacaagggcgtccgcgtcggcttcggccgcacccacgaccgccgctacacc
cgcctgctgcgcgacctgatcctcaccggccgcgccgaaccccagcgtgtcgtcacccac
cacggcccgctggaggacgcccccgccttctacaccgccttcgaccgccgtgaggacggc
gtgatcaaagcggtgctccacccctga

DBGET integrated database retrieval system