KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_03410Help
Entry
SCATT_03410       CDS       T02095                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:scy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:scy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scy00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:scy00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:scy00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scy00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:scy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
391697..392722
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVADHGDEVIGFHDGWKGLLECDYRKLDLDAVSGI
LARGGTILGSSRVQPAHLRDGVERARGHVDELGLDAIIPIGGEGTLKAARLLSDAGLPIV
GVPKTIDNDIASTDVTFGFDTAVMVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHA
GMAAGAHAIVVPERPFDITELTEVVRKRFEAGKKFAIVVVSEGAKPREGTMEFESGRTDV
YGHERFAGVARQLSVELEDRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHN
GDFGMMTALRGTDITLVPLAEAVEHLKTVPVERYIEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattggtgtgctgaccagcggcggcgactgccccggactgaacgccgtcatccgg
tcggtggtgcaccgcgccgtggccgaccacggtgacgaggtgatcggcttccacgacggc
tggaagggcctgctggagtgcgactaccgcaagctggacctggacgccgtcagcggcatc
ctggcccgcggcggcaccatcctgggctcctcccgggtgcagccggcccacctgcgggac
ggcgtggagcgggcccgggggcacgtcgacgagctgggcctggacgccatcatcccgatc
ggcggcgagggcacgctcaaggcggcccggctgctgtccgacgcggggctgccgatcgtc
ggggtgcccaagaccatcgacaacgacatcgcctccaccgatgtcaccttcggcttcgac
accgcggtgatggtggccaccgaggcgctggaccggctgaagaccaccgccgagtcccac
cagcgggtgctcatcgtcgaggtgatggggcgccacaccgggtggatcgcgctgcacgcc
gggatggcggcgggcgcccacgccatcgtggtcccggagcggccgttcgacatcaccgag
ctgaccgaggtggtccgcaagcggttcgaggcgggcaagaagttcgccatcgtggtggtc
tccgagggcgccaagccgcgtgagggcacgatggagttcgagagcggccgtaccgacgtc
tacggccacgagcggttcgccggggtggcccggcagctctcggtggagctggaggaccgc
ctgggcaaggaggcccggccggtgatcctcggccatgtgcagcgtggcggcaccccgacc
gcgtacgacagggtgctggccacccggttcggctggcacgcggtggaggcggcgcacaac
ggcgacttcggcatgatgaccgcgctgcgcggcaccgacatcaccctggtgccgctggcc
gaggcggtggagcacctcaagacggtcccggtggagcggtacatcgaggccgaatgcgtg
ctgtga

DBGET integrated database retrieval system