KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_05400Help
Entry
SCATT_05400       CDS       T02095                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635286..636563
Genome map
AA seq 425 aa AA seqDB search
MTDVTSDHEHAARLRDAVVDELVDRGEIVSKDVEAVMRKVARHAFTPEASLEDAYHTYNA
VVTKRNEHGRAVSSVSAPQIQAFMLEQAEVRPGMRVLEIGSGGLNAAYLAELVGNTGEVT
TVDIDPEVTERAARLLAQAGYPDVRVLLADATEGVAAHAPYDVIMVTVGSWDIPPAWIEQ
LTATGRLVVPLRIRGLVRSVAFQRQGNRLVSTSARICGFVSMQGAGAHEADLLLVNGTEE
IVLRFDDGLPADPGQLNNAVRSPRVEISTGVLVRRMEPVDTLQLYMATVLPGFCTMSVDA
GLDTGLVAPRNKGFSMACVEGANFAYITTRIAEDDAFAEFVVHAFGPGGPTLAEAIADHV
RTWDREHRGGPGPRITLYPAGTPDDQIPELPGGRVIDKTHCRVTLSWSPTATAAEDRATQ
HHTTE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgtgacctctgaccacgagcatgctgcgcgactgcgcgacgcggtcgtggac
gagcttgtcgaccgcggcgagatcgtttcaaaggacgtcgaagccgtgatgcgcaaggtc
gcgcggcacgcgttcacccctgaggcgagcctggaggacgcgtaccacacctacaacgca
gtggtcaccaagaggaacgagcatggcagggctgtcagctcggtgtccgccccgcagatc
caggcgttcatgctggagcaggccgaggtccgaccgggcatgcgggtgctggagatcggc
tccggcggcctgaacgcggcctacctggccgagctggtcgggaacaccggcgaggtcacc
accgtcgacatcgacccggaggtgacggagcgtgccgcgcgcctgctggcgcaggccggc
tacccggacgtgcgcgtgctgctcgccgatgccaccgagggcgttgcggctcacgccccc
tacgacgtgatcatggtgacggtcgggtcgtgggacattccgcccgcatggatcgagcag
ctcactgcaaccgggcgcctggtcgtgccgctgaggatccgtggtctggtgcgctcggtc
gccttccagcgccagggcaatcgactagtcagcacctcggcgcggatctgcgggttcgtg
tccatgcaaggtgccggagcgcacgaggccgatctgctgctggtcaacggcactgaggag
atcgtcctgcggttcgatgacggtctgcctgctgatccgggccagttgaacaacgcggtg
cgaagcccacgtgtcgagatctcgaccggggtcctggtccggcggatggagccggtggac
acgctccagctgtacatggccaccgtcctgcccggcttttgcaccatgtccgtggacgcg
ggcctggacaccgggctggtcgctccgcgcaacaagggcttttcgatggcctgcgtcgag
ggggcgaacttcgcctacatcaccacgcgtatcgcggaggatgatgccttcgcggaattc
gtggtccatgccttcggtccgggcggtcccacgctggccgaagcgatcgccgaccatgtg
cgcacatgggacagggaacaccgcggcggcccgggcccgcgcatcaccctttacccggcc
ggcacccccgatgaccagatccctgaacttcccggcggacgggtgatcgacaagacccac
tgccgggtcacgctctcctggtccccgaccgcgaccgccgccgaggaccgggcaacccag
caccacaccaccgagtaa

DBGET integrated database retrieval system