KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_10430Help
Entry
SCATT_10430       CDS       T02095                                 

Definition
magnesium-chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCATT_10430
Enzymes [BR:scy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SCATT_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137413..1139470
Genome map
AA seq 685 aa AA seqDB search
MSTTTPYPFTAIVGMADLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALSALMPPVEV
VPGCRFSCDPAAPDPGCPDGPHPADAGGATRAARMVELPVGASEDRLVGALDIERALAEG
KKAFEPGLLAAAHRGLLYVDEVNLLHDALVDLLLDAAAMGACYVEREGVSVRHAARFLLV
GTMNPEEGELRPQLLDRFGLTVEVAASREADERVEVVRRRLAYDDDPAAFAARWAAEEEA
LRERIAAARALLPSVVLGDAALRQIAAVCAAFDVDGMRADIVTARTATALAAWAGRTQVL
AEDVRQAALLALPHRRRRNPFDAPGLDERQLDDTLREFGGDDDPDPDGPDGPDGPGGGGP
DGPGGQPPRESGEDDGQSPPPSPSPTPGPGEATGNEAAEGEPRGAGSGGGEQAAAPAGEP
FKARTLTVAGLGDGAAGRRSRARTDHGRTIGARRPQGPLTRLHLAATVHAAAPHQRARGR
SGPGLVLRKDDLRQAVREGREGNLVLFVVDASGSMAARQRMTAVKGAVLSLLLDAYQRRD
KVGLITFRGTGAELALPPTSSVEVGAARLERLPTGGRTPLAAGLAKAREVLRVERLRDPA
RRPLLLVVTDGRATGGPEPVALATRAARQLAADQVASVVVDCESGPVRLGLAGALARDLA
GTAVTLEELRADTVSAVVRDARRAA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccaccccttacccgttcacggcgatcgtcgggatggccgatctgcggctg
gcgctgctgctcaacgccgtctccccggcggtgggcggggtgctggtgcgcggtgagaag
gggaccgccaagtcgaccgcggtacgggcgctgtcggccctgatgccgccggtcgaggtg
gtccccgggtgccgtttctcgtgcgacccggcggcgcccgacccgggctgcccggacggc
ccgcacccggcggacgcgggcggcgcgacccgtgcggcccgcatggtcgagctgccggtc
ggcgcctcggaggaccggctcgtcggcgccctggacatcgaacgcgccctcgccgagggg
aagaaggccttcgagccgggcctgctggccgcggcccaccgcgggctgctctacgtcgac
gaggtcaacctgctgcacgacgcgctggtcgacctgctgctggacgccgccgcgatgggc
gcctgctacgtggagcgggagggcgtctcggtgcgccacgcggcccgcttcctgctggtg
ggcacgatgaacccggaggagggcgagctgcgtccgcagctgctggaccgcttcgggctc
accgtggaggtggccgcctcgcgggaggcggacgagcgggtcgaggtggtgcgccgccgg
ctcgcctacgacgacgacccggccgccttcgcggcgcgctgggcggccgaggaggaggcg
ctgcgcgagcggatcgccgcggcgcgggcgctgctgccgtcggtggtgctcggtgacgcg
gcgctgcgccagatcgccgcggtgtgcgccgcgttcgacgtggacgggatgcgcgccgac
atcgtcaccgcccgtaccgccaccgcgctggccgcctgggcgggccgcacccaggtgctc
gccgaggacgtgcggcaggccgcgctgctggcgctgccgcaccggcgccgccgcaacccg
ttcgacgcgccgggcctggacgagcggcaactcgacgacaccttgcgggagttcggcggc
gacgacgacccggacccggacggaccggacggccccgacgggccgggcggcggcgggccg
gacggccccggcggacagcccccgcgcgagtccggggaggacgacggccagtcgccaccg
ccctccccctcccccacgcccggaccgggcgaggcgaccgggaacgaggcggccgagggc
gagccgcgcggcgcgggcagcggcggcggtgagcaggcggcggccccggccggagagccg
ttcaaggcccgcaccctgaccgtggccggcctcggcgacggggcggccgggcggcgttcc
cgggcccgtaccgaccatggccgcaccatcggcgcccgccgcccgcagggcccgctcacc
cggctccacctggccgccaccgtgcacgccgccgcgccgcaccagcgcgcccggggccgc
agcggaccggggctggtgctgcgcaaggacgacctgcgccaggcggtgcgcgagggccgc
gagggcaacctggtgctcttcgtggtggacgcctccggctcgatggcggcccggcagcgg
atgacggccgtcaagggcgccgtgctctccttgctgctcgacgcctaccagcggcgcgac
aaggtggggctgatcaccttccggggcaccggcgccgagctggcgctgccgcccacctcg
tcggtggaggtcggggccgcccggctggagcggctgcccaccggtggccgtaccccgctg
gccgccgggctcgccaaggcccgggaggtgctgcgggtggagcggctgcgggatccggca
cggcgcccgctgctgctggtggtgaccgacggccgggccaccggcgggccggaaccggtg
gcgctggccacccgggccgcccggcagctcgccgccgaccaggtggcctcggtggtggtg
gactgcgagtccgggccggtgcggctgggtctggcgggcgcgctcgcccgcgacctggcg
ggcaccgcggtgacgctggaggagttgcgcgcggacaccgtgtccgccgtggtacgggac
gcgaggagggccgcgtaa

DBGET integrated database retrieval system