KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_10990Help
Entry
SCATT_10990       CDS       T02095                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00010  Glycolysis / Gluconeogenesis
scy00051  Fructose and mannose metabolism
scy00562  Inositol phosphate metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01200  Carbon metabolism
scy01230  Biosynthesis of amino acids
Module
scy_M00002  Glycolysis, core module involving three-carbon compounds
scy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_10990
   00051 Fructose and mannose metabolism
    SCATT_10990
   00562 Inositol phosphate metabolism
    SCATT_10990
Enzymes [BR:scy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCATT_10990
Exosome [BR:scy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCATT_10990
  Exosomal proteins of bladder cancer cells
   SCATT_10990
  Exosomal proteins of melanoma cells
   SCATT_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEW93470
UniProt: F8JYZ6
Position
complement(1195280..1196056)
Genome map
AA seq 258 aa AA seqDB search
MSTRTPLIAGNWKMNLNHLEAIAHVQKLAFALTDKDHDAVEVAVLPPFTDLRSVQTLVDG
DKLRIKYGAQDLSAHDSGAYTGEISGAMLAKLKCAFVAIGHSERRQYHGETDEQVNAKVK
AAYRHGLTPILCVGEGLEVREAGNQVAHTLAQVDGALKDVPADQARTIVIAYEPVWAIGT
GKVATPEDAQEVCGAIRARLAELYDAGVADAVRIQYGGSVKSGNIAAIMAQADVDGALVG
GACLDADEFVKIVRYGEQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcgcaccccgctgatcgcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctcgccttcgcgctcaccgacaaggaccacgacgccgtg
gaggtcgcggtcctgccgcccttcacggacctgcgttcggtgcagaccctggtcgacggc
gacaagctgcgcatcaagtacggcgcgcaggacctgtccgcgcacgactcgggcgcgtac
accggtgagatctcgggcgccatgctggccaagctcaagtgcgccttcgtggccatcggc
cacagcgagcgccgccagtaccacggcgagaccgacgagcaggtcaacgccaaggtgaag
gcggcctaccggcacggcctgaccccgatcctgtgcgtcggggaggggctggaggtccgc
gaggcgggcaaccaggtggcccacaccctcgcccaggtggacggcgccctgaaggacgtc
ccggccgaccaggcgcgcaccatcgtgatcgcctacgagccggtgtgggcgatcggcacc
ggcaaggtggccacccccgaggacgcccaggaggtctgcggggcgatccgcgcccggctg
gccgagctgtacgacgccggggtcgccgacgccgtgcggatccagtacggcggctcggtg
aagtccggcaacatcgcggcgatcatggcccaggccgacgtggacggcgccctggtcggc
ggcgcctgcctggacgccgacgagttcgtgaagatcgtccggtacggggaacagtag

DBGET integrated database retrieval system