KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_10990Help
Entry
SCATT_10990       CDS       T02095                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_10990
   01230 Biosynthesis of amino acids
    SCATT_10990
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_10990
   00051 Fructose and mannose metabolism
    SCATT_10990
   00562 Inositol phosphate metabolism
    SCATT_10990
Enzymes [BR:scy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCATT_10990
Exosome [BR:scy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCATT_10990
  Exosomal proteins of bladder cancer cells
   SCATT_10990
  Exosomal proteins of melanoma cells
   SCATT_10990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1195280..1196056)
Genome map
AA seq 258 aa AA seqDB search
MSTRTPLIAGNWKMNLNHLEAIAHVQKLAFALTDKDHDAVEVAVLPPFTDLRSVQTLVDG
DKLRIKYGAQDLSAHDSGAYTGEISGAMLAKLKCAFVAIGHSERRQYHGETDEQVNAKVK
AAYRHGLTPILCVGEGLEVREAGNQVAHTLAQVDGALKDVPADQARTIVIAYEPVWAIGT
GKVATPEDAQEVCGAIRARLAELYDAGVADAVRIQYGGSVKSGNIAAIMAQADVDGALVG
GACLDADEFVKIVRYGEQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcgcaccccgctgatcgcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctcgccttcgcgctcaccgacaaggaccacgacgccgtg
gaggtcgcggtcctgccgcccttcacggacctgcgttcggtgcagaccctggtcgacggc
gacaagctgcgcatcaagtacggcgcgcaggacctgtccgcgcacgactcgggcgcgtac
accggtgagatctcgggcgccatgctggccaagctcaagtgcgccttcgtggccatcggc
cacagcgagcgccgccagtaccacggcgagaccgacgagcaggtcaacgccaaggtgaag
gcggcctaccggcacggcctgaccccgatcctgtgcgtcggggaggggctggaggtccgc
gaggcgggcaaccaggtggcccacaccctcgcccaggtggacggcgccctgaaggacgtc
ccggccgaccaggcgcgcaccatcgtgatcgcctacgagccggtgtgggcgatcggcacc
ggcaaggtggccacccccgaggacgcccaggaggtctgcggggcgatccgcgcccggctg
gccgagctgtacgacgccggggtcgccgacgccgtgcggatccagtacggcggctcggtg
aagtccggcaacatcgcggcgatcatggcccaggccgacgtggacggcgccctggtcggc
ggcgcctgcctggacgccgacgagttcgtgaagatcgtccggtacggggaacagtag

DBGET integrated database retrieval system