KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_11550Help
Entry
SCATT_11550       CDS       T02095                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCATT_11550
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCATT_11550
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCATT_11550
Enzymes [BR:scy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCATT_11550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1271315..1272553)
Genome map
AA seq 412 aa AA seqDB search
MSTDFFIPDTAGQVPSAAGYFGRFGGKFIPEALVAAVDEVAAEYEKAKADPAFAAELGDL
LVNYAGRPSALTEAARFAEHAGGARIFLKREDLNHTGSHKINNVLGQALLTRRMGKTRVI
AETGAGQHGVATATACALFGLECTIYMGEVDTERQALNVARMRMLGAEVVAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTAAGPHPFPALVRDFHRVIGVEARRQLLERAGRLPDAV
LACVGGGSNAIGVFHAFLPDEGVRLIGLEAAGHGVDSGEHAATLTAGDPGILHGSRSYVL
QDEDGQITEPYSISAGLDYPGIGPEHSYLKDTGRAEYRPVTDDEAMQALRLLSRTEGIIP
AIESAHALAGALQAGRELGPDALLLVNLSGRGDKDMDTAARYFGLYPSEGAK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacttcttcatcccggacacggcgggccaggtgcccagcgccgccgggtac
ttcggccgcttcggcggcaagttcatccccgaggccctggtggccgcggtcgacgaggtc
gccgcggagtacgagaaggccaaggccgaccccgccttcgccgccgaactcggcgacctg
ctggtcaactacgccggccgccccagcgcgctgaccgaggccgcgcgcttcgccgagcac
gccggcggcgcccggatcttcctcaagcgcgaggacctcaaccacaccggctcccacaag
atcaacaacgtgctgggccaggccctgctcacccggcggatgggcaagacccgggtgatc
gccgagaccggcgccggacagcacggcgtggccaccgccaccgcctgcgccctgttcggc
ctggagtgcaccatctacatgggcgaggtcgacaccgagcgccaggcgctcaacgtcgcc
cggatgcgcatgctcggcgccgaggtggtcgccgtgaagtccggcagccgcaccctgaag
gacgccatcaacgaggcgttccgcgactgggtggccaacgtcgaccgcacccactacctg
ttcggcaccgcggccggcccgcaccccttcccggccctggtccgcgacttccaccgggtc
atcggcgtcgaggcccgccgccagctgctggagcgcgccgggcggctgccggacgccgtc
ctcgcctgcgtcggcggcggctccaacgccatcggggtcttccacgccttcctgcccgac
gagggcgtccggctgatcggcctggaggcggccggccacggcgtggactccggcgagcac
gcggccaccctcaccgccggcgaccccggcatcctgcacggctcgcgctcctacgtcctc
caggacgaggacggccagatcaccgagccgtactcgatctcggccggcctggactacccc
ggcatcggcccggagcactcgtacctgaaggacaccgggcgcgccgagtaccgcccggtc
accgacgacgaggcgatgcaggcgctgcggctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctcgccggcgccctccaggccggccgggaactcggcccc
gacgccctgctgctggtcaacctctccggccggggcgacaaggacatggacaccgccgcc
cgctacttcgggctctacccttcggaaggtgccaagtga

DBGET integrated database retrieval system