KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_11560Help
Entry
SCATT_11560       CDS       T02095                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCATT_11560
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCATT_11560
Enzymes [BR:scy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SCATT_11560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1273025..1273834)
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIIEGVRADLAQRQARVPLDELKERAAKAPRAKDGVAALRGDGVKVICEVKRSSP
SKGALAAIADPAGLAADYEAGGAAVISVLTEERRFGGSLADLEAVRARVDTPVLRKDFIV
TAYQLWEARAYGADLALLIVAALDQEALVSLIERAESIGLTPLVEVHDEDEVERAVAAGA
KVVGVNARDLRTLRVDRDTFARLAPEIPGHVVKVAESGVRGPHDLIAYANDGADAVLVGE
SLVTGRDPKTAVADLVAAGAHPALRHGRD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgctcgacgagatcatcgagggtgtccgcgcggacctcgcgcagcggcaggcc
cgcgtccccctcgacgagctcaaggagcgagccgccaaggcaccgcgggccaaggacggc
gtggccgcgctgcgcggcgacggcgtcaaggtgatctgcgaggtcaagcgctccagcccg
tccaagggcgcgctcgccgccatcgccgacccggccgggctcgccgccgactacgaggcc
ggcggcgccgcggtgatcagcgtgctcaccgaggagcgccggttcggtggctccctggcc
gacctggaggcggtccgcgcccgggtcgacaccccggtgctgcgcaaggacttcatcgtc
accgcctaccagctgtgggaggcccgggcctacggcgccgacctcgcgctgctcatcgtc
gccgccctcgaccaggaggcgctggtctcgctgatcgagcgggccgagtccatcgggctc
accccgctggtggaggtgcacgacgaggacgaggtcgagcgcgcggtggccgccggcgcc
aaggtcgtcggggtcaacgcccgcgacctgcgcacgctgcgggtggaccgcgacaccttc
gcccgcctcgccccggagatccccggccacgtcgtcaaggtcgccgaatccggcgtccgc
ggcccgcacgacctgatcgcctacgccaacgacggcgccgacgccgtactcgtcggcgag
tccctggtcaccgggcgcgacccgaagaccgcggtggccgacctggtcgccgccggcgcc
caccccgcgctgcgccacggacgggactga

DBGET integrated database retrieval system