KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_12060Help
Entry
SCATT_12060       CDS       T02095                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCATT_12060
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCATT_12060
Enzymes [BR:scy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SCATT_12060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1321646..1323271)
Genome map
AA seq 541 aa AA seqDB search
MPHADQSTTLHRGGTPNAHDGPGKQPGPPRPSQVRPKPLAELAGQLGTAAPAGDALVTGI
THDSRAVRPGDIYAALPGARFHGADFTAQAAERGAVAVLTDPAGRDRAAATGLPVLTVAD
PRARMGALAAAVYDEPGRDLLQIGITGTSGKTTTAYLVEGGLRAVHGDDTGLIGTVESRI
GTERLKSERTTPEATDLQALFAAMRERGVRAVAMEVSSHALVLGRVDGAVFDVAVFTNLS
PEHMEFHSGMEDYFQAKAQLFTPARSRRGVVNHDDEYGRRLLAEATVPLVSFSAEGHPDA
DWRAEEVVVGTEGSTFTAVGPGGERIRAAAPLPGPFNVANALAALVALVTAGIDARTAAD
GIAAVTGVPGRLERVDAGQPFLAVVDYAHKTDAVESVLRALRKVTEGRVHIVLGCGGDRD
QHKRGPMGAACARLADTAVLTSDNPRSEDPLAILAAMLAGAAEVPAHERGHVTVEPDRAT
AIATAVARAEPGDTVLVAGKGHEQGQDIAGVVRPFDDREVLREAIEHASRRQPQPKDQDQ
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
gtgccacatgctgatcagtccaccaccctgcaccgcgggggtacccccaacgcgcacgac
ggcccgggcaagcagccgggccctccgcgcccgtcccaggtccgccccaagccgctcgcg
gaactggccgggcagctcggcaccgcggcgccggccggggacgccctcgtcaccggcatc
acccacgactcgcgggcggtgcgccccggtgacatctacgcggccctgcccggcgcccgg
ttccacggcgccgacttcaccgcgcaggccgccgaacgcggggccgtcgccgtactgacc
gaccccgcggggcgcgaccgcgcggcggccaccgggctgccggtgctcaccgtcgccgat
ccgcgcgcccggatgggggcgctcgccgccgccgtctacgacgagcccggccgcgacctg
ctccagatcggcatcaccggcacctccggcaagaccaccaccgcctacctggtggaaggc
gggctgcgcgcggtccacggcgacgacaccgggctgatcggcaccgtcgagtcgcggatc
ggcaccgaacggctcaagagcgaacgcaccacgcccgaggccaccgacctccaggcgctc
ttcgccgccatgcgcgagcgcggggtgcgggcggtggccatggaggtctccagccacgcc
ctggtgctcggccgggtcgacggcgccgtcttcgacgtggccgtcttcaccaacctcagc
ccggagcacatggagttccactccggcatggaggactacttccaggccaaggcgcagttg
ttcaccccggcgcgcagccgccgcggcgtggtcaaccacgacgacgagtacggccgccgg
ctgctcgccgaggccaccgtgccgctggtgagcttctccgccgagggccacccggacgcc
gactggcgggccgaggaggtggtggtgggcaccgagggcagcaccttcaccgccgtcggc
cccgggggcgagcggatccgcgccgccgcgccgctgcccggcccgttcaacgtcgccaac
gcgctggccgccctggtcgccctggtcaccgccgggatcgacgcgcggaccgccgccgac
ggcatcgccgcggtgaccggcgtccccggccgcctcgaacgggtcgacgccggacagccg
ttcctggccgtggtggactacgcgcacaagaccgacgccgtcgaatcggtgctgcgcgcg
ctgcgcaaggtcaccgagggccgcgtccacatcgtgctcggctgcggcggcgaccgcgac
cagcacaagcgcggaccgatgggcgccgcctgcgcccggctcgcggacaccgccgtactc
acctcggacaacccccgttccgaggacccgctggcgatcctggccgccatgctcgccggt
gccgccgaggtaccggcccatgaacgcggccatgtcaccgtggagcccgaccgggccacc
gcgatcgccaccgccgtggcccgcgccgagccgggcgacaccgtgctcgtcgcgggcaag
ggccatgagcagggccaggacatcgccggagtggtacgccccttcgacgaccgggaggtg
ctgcgcgaggcgatcgagcacgcctcgcgtcggcagccgcagccaaaggaccaggaccag
cagtga

DBGET integrated database retrieval system