KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_12470Help
Entry
SCATT_12470       CDS       T02095                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_12470
   01230 Biosynthesis of amino acids
    SCATT_12470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_12470
   00030 Pentose phosphate pathway
    SCATT_12470
   00051 Fructose and mannose metabolism
    SCATT_12470
   00052 Galactose metabolism
    SCATT_12470
  Energy metabolism
   00680 Methane metabolism
    SCATT_12470
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SCATT_12470
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCATT_12470
Protein phosphatases and associated proteins [BR:scy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCATT_12470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1362134..1363165)
Genome map
AA seq 343 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAMVRKGVQNHGFEFTGFRDGWRGPLEGLTRQLDIPAVRGI
LPRGGTILGSSRTNPLKAENGVRRVKENLAKYEVDALVAIGGEDTLGVAARLYDEYGVPC
VGVPKTIDNDLSATDYTFGFDTAVNIATEAIDRLHTTAESHMRVLVVEVMGRHAGWIALH
AGLAGGANVILLPEQRFDLDQVCGWVESRFQASYAPIVVVAEGAMPKDGDLVVKDADQLD
SFGHVRLSGIGDWLAKEIEKRTGKEARTTVLGHIQRGGTPTAFDRWLATRFGLHAIDAVR
DREFGTMVALRGTDIVRVPLTEATAKLKTVDPALYAEAGVFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggagtgctgaccggcggcggcgactgccccggtctcaacgccgtgatccgg
gccatggtccgcaagggcgtacagaaccacgggttcgagttcacgggcttccgcgacggc
tggcgcggcccgctcgaagggctcaccaggcaactggacatccccgcggtccgcggcatc
ctgccccgcggcggcaccatcctcggctcctcccgcaccaaccccctcaaggccgagaac
ggggtccgccgggtcaaggagaacctcgccaagtacgaggtggacgccctcgtcgcgatc
ggcggcgaggacaccctgggggtggccgcccggctgtacgacgagtacggcgtcccctgc
gtcggcgtacccaagaccatcgacaacgacctgagcgccaccgactacaccttcggcttc
gacaccgcggtcaacatcgccaccgaggccatcgaccggctgcacaccaccgccgagtcc
cacatgcgggtgctggtggtggaggtgatgggccggcacgccggatggatcgcgctgcac
gccgggctcgcgggcggcgccaacgtcatcctcctgcccgagcagcgcttcgacctcgac
caggtctgcggctgggtggagtcccgtttccaggccagctacgcgccgatcgtggtggtc
gccgagggcgccatgcccaaggacggcgacctggtggtcaaggacgccgaccagctcgac
tccttcggccacgtacgcctctccggcatcggcgactggctcgccaaggagatcgagaag
cgcaccggcaaggaggcccgcaccaccgtgctcggccacatccagcgcggcggcaccccc
accgccttcgaccgctggctcgccacccgcttcggcctgcacgccatcgacgcggtacgg
gaccgggagttcggcaccatggtcgcgctgcgcggcaccgacatcgtccgggtaccgctc
accgaggccaccgccaagctcaagacggtcgacccggcgctctacgccgaggcgggcgtc
ttcttcggctga

DBGET integrated database retrieval system