KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_12510Help
Entry
SCATT_12510       CDS       T02095                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1366256..1367050
Genome map
AA seq 264 aa AA seqDB search
MPLLPGAEPYRHDGGEVGVLLCHGFTGSPQSMRPWGEYLADRGLSVSVPLLPGHGTRWQD
MQITGWQDWYAEVERELLALRDRCRRVFVFGLSMGGSLTLRLAARHPSEVSGIALVNPAV
RAYGAAFKAVPVLRHLMPSVAGIASDIAKDGQAEVGYDRTPLHAVYAMTRLWRLVEADLP
RVTAPLLLMTSRVDHVVDPANSDVVAAGVGSTDITRRTLDRSYHVATLDHDAEEIFRTSY
AFVRRLEPEAAPATEGTADEVAGG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgcttcctggtgccgagccgtaccgccacgacggcggcgaggtcggagtgctg
ttgtgccacggattcaccggctcccctcagtcgatgcgcccctggggcgagtatctcgcc
gaccgcgggctctccgtctccgtaccgctgcttcccggccacggcacccgctggcaggac
atgcagatcaccggctggcaggactggtacgcggaggtggaacgggagctgctcgcgctg
cgggaccgctgccgccgggtcttcgtcttcgggctgtccatgggcggctccctcaccctg
cggctggccgcccggcacccgtccgaggtcagcggcatcgccctggtgaacccggctgtg
cgggcgtacggcgccgcgttcaaggcggttccggtgctgcggcatctgatgccgtcggtg
gccgggatcgccagcgacatcgccaaggacggtcaggccgaggtggggtacgaccgcacg
ccgctgcacgccgtgtacgcgatgaccaggctgtggcggctggtggaggccgatctgccg
cgggtgacggcgccgctgctgctgatgaccagccgggtcgaccacgtggtggacccggcc
aactccgacgtcgtggcggccggcgtcggcagcaccgacatcacccggcgcaccctggac
cgcagctaccacgtggccaccctcgaccacgacgcggaggagatcttccgcacctcgtac
gcgttcgtgcggcggctggagccggaggcggcaccggccacggagggtacggcggacgag
gtggccggtggctga

DBGET integrated database retrieval system