KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_16360Help
Entry
SCATT_16360       CDS       T02095                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:scy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1760762..1761907)
Genome map
AA seq 381 aa AA seqDB search
MTVDGRRQGGDVRHEVTAARRIVVKIGSSSLTTAVGGLATDRMDALVEVLAGARDGAKEI
VLVSSGAIAAGLAPLGLERRPRDLARQQAAASVGQGLLVAGYTAAFARHGIRVGQVLLTA
DDVSRRAHYRNAYRTFEQLLAMGALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLL
VLLSDVDGVYDGDPSRPGSRRIPEVAGPGDLAGVEIGSAGKAGVGTGGMVTKVQAARIAA
DAGIPVVLTSAAEAADALAGRPTGTFFHATGKRSAVRLLWLEHASEPRGALRLDAGAVRA
VVERRTSLLPAGLTGVEGQFSAGDPVDLLDEEGRAVARGLVNFDAEELPRLLGRSTRELA
AEFGPEYEREVVHRDDLVVLH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgacagtggacggccggcgacagggcggggacgtacggcacgaggtgacggcggcgcgc
cggatcgtcgtcaagatcggctcctcctcactgaccaccgccgtcggcgggctggccacc
gaccggatggacgccctggtggaggtgctcgccggggcgcgggacggcgccaaggagatc
gtgctggtctcctccggcgcgatcgccgccgggctggccccgctcggcctggagcgccgc
ccgcgtgacctggcccggcagcaggccgccgccagcgtcggccaggggctgctggtggcc
gggtacaccgcggccttcgcccgccacggcatccgggtcgggcaggtgctgctcaccgcc
gacgacgtcagccgccgggcccactaccgcaacgcctaccgcaccttcgagcagctgctg
gccatgggcgcgctgccggtggtcaacgagaacgacacggtggccaccgacgagatccgg
ttcggtgacaacgaccggctcgccgccctcgtcgcccacctggtccgggccgatctgctg
gtgctcctctccgacgtggacggggtctacgacggcgacccgagccgcccgggcagccgg
cgcatccccgaggtggccggccccggcgacctcgccggggtggagatcggcagcgccggc
aaggcgggcgtgggcaccggcggcatggtgaccaaggtgcaggcggcccggatcgccgcc
gacgccgggatcccggtggtgctgacctccgccgccgaggccgccgacgccctggccggc
cgccccaccggcaccttcttccacgccaccggcaagcgctcggcggtccggctgctgtgg
ctggagcacgcctccgaaccgcgcggcgcgctgcgcctggacgcgggcgcggtacgggcg
gtggtggagcggcgcacctcgctgctgccggccgggctcaccggggtcgagggccagttc
tccgccggcgacccggtcgacctgctggacgaggagggccgggcggtcgcccgcgggctg
gtcaacttcgacgccgaggagctgccccggctgctcggccgctccacccgcgagctggcc
gccgagttcggcccggagtacgaacgcgaggtcgtccaccgcgacgacctggtggtgctg
cactga

DBGET integrated database retrieval system