KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_18420Help
Entry
SCATT_18420       CDS       T02095                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:scy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1956076..1957047)
Genome map
AA seq 323 aa AA seqDB search
MTTSEPRGPIDSSRVPRFAGPATFARLPRLDEVGTTDVAVVGVPFDAGVSYRPGARFGGN
AIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETIQAAADDLLDTGARL
MTLGGDHTIALPLLRSVARRHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGILD
TSALSHVGTRGPLYGKRDLDDDAKMGFGIVTSADVMRRGVDEVAQQLRERIGDRPLYISI
DIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLAGCNLVSADVVEVAPAYDHAEITSVAA
SHTAYELTTLMARQIAAARGTGA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgagccgcgcggtccgatcgactcctcccgcgtcccccgtttcgccggc
ccggccaccttcgcccggctgccccggctggacgaggtcggcaccaccgacgtcgccgtg
gtgggcgtgccgttcgacgccggggtctcctaccgccccggcgcccgcttcggcggcaac
gccatccgtgaggcctcccgcctgctgcgcccgtacaacccggcgcaggacgcctccccg
ttcgcgctggcccaggtcgccgacgccggggacatagcggccaacccgttcaacatcaac
gaggcggtcgagaccatccaggccgccgccgacgacctgctcgacaccggcgcccggctg
atgacgctcggcggcgaccacaccatcgcgctgcccctgctgcgttccgtcgcccgcagg
cacggccccgtcgcgctgctccacttcgacgcccacctggacacctgggacacctacttc
ggcgccgagtacacccacggcaccccgttccgccgcgccgtcgaggagggcatcctcgac
acctccgccctctcccacgtcggcacccgcggcccgctctacggcaagcgggacctggac
gacgacgccaagatgggcttcggcatcgtcacctccgccgacgtcatgcggcgcggcgtg
gacgaggtcgcccagcaactgcgcgagcgcatcggcgaccgcccgctgtacatctccatc
gacatcgacgtgctcgacccggcgcacgccccgggcaccggcacccccgaggccggcggc
atgacctcgcgcgaactgctggagatcctgcgcggcctggccggctgcaacctggtctcc
gccgacgtcgtcgaggtggccccggcctacgaccacgcggagatcacctccgtcgccgcc
tcgcacaccgcctacgagctgaccaccctcatggcgcggcagatcgccgccgcccgggga
accggcgcctga

DBGET integrated database retrieval system