KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_18420Help
Entry
SCATT_18420       CDS       T02095                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00330  Arginine and proline metabolism
scy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCATT_18420
Enzymes [BR:scy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SCATT_18420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489 DUF3373
Motif
Other DBs
NCBI-ProteinID: AEW94213
UniProt: F8JSA0
Position
complement(1956076..1957047)
Genome map
AA seq 323 aa AA seqDB search
MTTSEPRGPIDSSRVPRFAGPATFARLPRLDEVGTTDVAVVGVPFDAGVSYRPGARFGGN
AIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETIQAAADDLLDTGARL
MTLGGDHTIALPLLRSVARRHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGILD
TSALSHVGTRGPLYGKRDLDDDAKMGFGIVTSADVMRRGVDEVAQQLRERIGDRPLYISI
DIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLAGCNLVSADVVEVAPAYDHAEITSVAA
SHTAYELTTLMARQIAAARGTGA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagcgagccgcgcggtccgatcgactcctcccgcgtcccccgtttcgccggc
ccggccaccttcgcccggctgccccggctggacgaggtcggcaccaccgacgtcgccgtg
gtgggcgtgccgttcgacgccggggtctcctaccgccccggcgcccgcttcggcggcaac
gccatccgtgaggcctcccgcctgctgcgcccgtacaacccggcgcaggacgcctccccg
ttcgcgctggcccaggtcgccgacgccggggacatagcggccaacccgttcaacatcaac
gaggcggtcgagaccatccaggccgccgccgacgacctgctcgacaccggcgcccggctg
atgacgctcggcggcgaccacaccatcgcgctgcccctgctgcgttccgtcgcccgcagg
cacggccccgtcgcgctgctccacttcgacgcccacctggacacctgggacacctacttc
ggcgccgagtacacccacggcaccccgttccgccgcgccgtcgaggagggcatcctcgac
acctccgccctctcccacgtcggcacccgcggcccgctctacggcaagcgggacctggac
gacgacgccaagatgggcttcggcatcgtcacctccgccgacgtcatgcggcgcggcgtg
gacgaggtcgcccagcaactgcgcgagcgcatcggcgaccgcccgctgtacatctccatc
gacatcgacgtgctcgacccggcgcacgccccgggcaccggcacccccgaggccggcggc
atgacctcgcgcgaactgctggagatcctgcgcggcctggccggctgcaacctggtctcc
gccgacgtcgtcgaggtggccccggcctacgaccacgcggagatcacctccgtcgccgcc
tcgcacaccgcctacgagctgaccaccctcatggcgcggcagatcgccgccgcccgggga
accggcgcctga

DBGET integrated database retrieval system