KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_20260Help
Entry
SCATT_20260       CDS       T02095                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SCATT_20260
Enzymes [BR:scy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     SCATT_20260
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     SCATT_20260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2166696..2167997
Genome map
AA seq 433 aa AA seqDB search
MSTPGYRVWGVTGIPEVRPGDDLAALIAAAGPELADGDVLLVTSKIVSKAEGRVVAADDR
EAAIDAETVRVVARRGRLRIVENRNGLVMAAAGVDASNTAPGTVLLLPEDPDASARRLRA
GLAAALGVDVAVVLTDTFGRPWRTGLTDVAIGAAGLTVLHDLRGATDSHGNELNVTVVAV
ADELAAAAELVKGKADGVPVAVVRGLGHLVRDDDGPGARALARGAADDMFRLGTSEALRQ
AVTLRRTVREFTDEPVDGAAVRRAVAAAVTAPAPHHTTPWRFVLLESADSRRRLLDAMRD
AWRADLERDGFPPPNVERRLRRGDVLRRAPYLVVPCLVDEGAHAYPDERRATAEREMFVV
SAGAAVQNLLVALAGEQLGSAWVSSTMFCRDVVRKVLDLPPSWDPMGAVAVGRPATAPPA
RPERDAEGFVEVR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgcccggctaccgggtgtggggcgtgaccgggatccccgaggtacgccccggc
gacgacctggccgcgctgatcgccgcggccggccccgaactggccgacggggacgtgctg
ctggtcacctccaagatcgtcagcaaggccgagggccgcgtcgtcgccgccgacgaccgc
gaggcggccatcgacgcggagacggtacgggtggtggcccggcgcggacggctgcgcatc
gtggagaaccgcaacggcctggtgatggccgcggccggggtggacgcctccaacaccgcc
cccggcaccgtcctgctgctgcccgaggacccggacgcctcggcccgccggctgcgcgcg
ggactggccgcggcgctcggcgtcgacgtcgccgtggtcctcaccgacaccttcggccgc
ccctggcgcaccggtctgaccgacgtggcgatcggcgccgccggcctgaccgtcctgcac
gacctgcgcggcgccaccgactcgcacggcaacgaactcaacgtcaccgtggtcgccgtc
gccgacgaactcgccgccgccgccgaactcgtcaagggcaaggccgacggggtgccggtg
gccgtggtccgcggactgggccacctggtacgggacgacgacggccccggcgcccgcgcg
ctggcccgcggcgcggccgacgacatgttccggctgggcacctcggaggcgctgcggcag
gcggtgacgttgcggcgtacggtgcgggagttcaccgacgagccggtggacggggccgcg
gtacgccgcgcggtggccgccgccgtcaccgcgcccgcgccgcaccacaccacgccgtgg
cggttcgtcctgctggagtccgccgactcccggcggcggctgctcgacgccatgcgggac
gcctggcgggccgacctggaacgggacggcttcccgccgccgaacgtcgaacgccggctg
cgccgcggggacgtactgcgccgggcgccgtacctggtggtgccctgcctggtggacgag
ggcgcgcacgcctacccggacgagcggcgggccaccgcggaacgcgagatgttcgtcgtc
tcggccggcgccgccgtgcagaacctgctggtcgccctcgccggggaacagctcggctcg
gcctgggtctcctcgacgatgttctgccgggacgtggtgcgcaaggtcctcgacctgccg
ccgtcctgggacccgatgggcgcggtggccgtgggccgccccgcgacggccccgccggcc
cggccggaacgcgacgcggaggggttcgtggaggtccgctga

DBGET integrated database retrieval system