KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_21190Help
Entry
SCATT_21190       CDS       T02095                                 

Definition
fatty acid desaturase (membrane)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCATT_21190
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SCATT_21190
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SCATT_21190
Lipid biosynthesis proteins [BR:scy01004]
 Desaturase
  First
   SCATT_21190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2269510..2270508
Genome map
AA seq 332 aa AA seqDB search
MTTQPDVITESREPGARPAREGSELPLATLGGDNKRSIEQITLALFIGVPFAALVAAIPI
AWGWGMSWLDLGLMVGMYFLGCHGITVGFHRYFTHGSFKAKRPLRIALAIAGSLAVEGPV
VRWVADHRKHHKFSDAEGDPHSPWRYGETVPALLKGLWWAHMGWMFDEEQTPQHKYAPDL
IKDPAIRRISRQFVMWTVISLLFPALVGGLATMSWQGALSAFFWGSLVRVALLHHVTWSI
NSICHAVGKRPFRSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVLRGQVDSSARII
RWFEKLGWASDVRWPSRERIAARRKEDVAKAA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacagccggacgtgatcaccgagtcccgggagcccggggcccgtccagcgcgg
gagggctccgagctgccgctcgccacgctgggcggggacaacaagcgctccatcgagcag
atcaccttggcgctgttcatcggggtgccgttcgcggcgctggtggcggcgatcccgatc
gcctggggctgggggatgtcctggctggacctcgggctgatggtggggatgtacttcctg
ggctgccacgggatcacggtgggcttccaccggtacttcacgcacggctcgttcaaggcc
aagcggccgttgcggatcgcgctggcgatcgccggttcgctggcggtggaggggccggtc
gtgcggtgggtggccgaccaccgcaagcaccacaagttctccgacgccgagggcgacccg
cattcgccgtggcggtacggcgagacggtcccggcgctgctgaaggggttgtggtgggcc
cacatgggctggatgttcgacgaggagcagacgccgcagcacaagtacgcgccggatctg
atcaaggacccggcgatccgccggatctcgcggcagttcgtgatgtggaccgtcatctcg
ctgctgttcccggcgctggtcggggggttggcgacgatgagctggcagggcgcgttgtcg
gcgttcttctggggctcgctggtgcgggtggcgctgctgcaccacgtgacgtggtcgatc
aactcgatctgccacgcggtgggcaagcgtccgttccggtcgcgggaccggtcggggaac
gtgtggtggctggcggtgctgtcgtgcggtgagtcctggcacaacctgcatcacgcggat
ccgacgtcggcgcgtcacggggtgctgcggggtcaggtggattcgagtgcgcggatcatc
cggtggttcgagaagctgggctgggcgagcgatgtgcgctggccgagccgggagcggatc
gccgcccggcgtaaggaagatgtcgccaaggcggcatga

DBGET integrated database retrieval system