KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_21190Help
Entry
SCATT_21190       CDS       T02095                                 

Definition
fatty acid desaturase (membrane)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:scy01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:scy01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2269510..2270508
Genome map
AA seq 332 aa AA seqDB search
MTTQPDVITESREPGARPAREGSELPLATLGGDNKRSIEQITLALFIGVPFAALVAAIPI
AWGWGMSWLDLGLMVGMYFLGCHGITVGFHRYFTHGSFKAKRPLRIALAIAGSLAVEGPV
VRWVADHRKHHKFSDAEGDPHSPWRYGETVPALLKGLWWAHMGWMFDEEQTPQHKYAPDL
IKDPAIRRISRQFVMWTVISLLFPALVGGLATMSWQGALSAFFWGSLVRVALLHHVTWSI
NSICHAVGKRPFRSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVLRGQVDSSARII
RWFEKLGWASDVRWPSRERIAARRKEDVAKAA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacagccggacgtgatcaccgagtcccgggagcccggggcccgtccagcgcgg
gagggctccgagctgccgctcgccacgctgggcggggacaacaagcgctccatcgagcag
atcaccttggcgctgttcatcggggtgccgttcgcggcgctggtggcggcgatcccgatc
gcctggggctgggggatgtcctggctggacctcgggctgatggtggggatgtacttcctg
ggctgccacgggatcacggtgggcttccaccggtacttcacgcacggctcgttcaaggcc
aagcggccgttgcggatcgcgctggcgatcgccggttcgctggcggtggaggggccggtc
gtgcggtgggtggccgaccaccgcaagcaccacaagttctccgacgccgagggcgacccg
cattcgccgtggcggtacggcgagacggtcccggcgctgctgaaggggttgtggtgggcc
cacatgggctggatgttcgacgaggagcagacgccgcagcacaagtacgcgccggatctg
atcaaggacccggcgatccgccggatctcgcggcagttcgtgatgtggaccgtcatctcg
ctgctgttcccggcgctggtcggggggttggcgacgatgagctggcagggcgcgttgtcg
gcgttcttctggggctcgctggtgcgggtggcgctgctgcaccacgtgacgtggtcgatc
aactcgatctgccacgcggtgggcaagcgtccgttccggtcgcgggaccggtcggggaac
gtgtggtggctggcggtgctgtcgtgcggtgagtcctggcacaacctgcatcacgcggat
ccgacgtcggcgcgtcacggggtgctgcggggtcaggtggattcgagtgcgcggatcatc
cggtggttcgagaagctgggctgggcgagcgatgtgcgctggccgagccgggagcggatc
gccgcccggcgtaaggaagatgtcgccaaggcggcatga

DBGET integrated database retrieval system