KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_21340Help
Entry
SCATT_21340       CDS       T02095                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:scy00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2284398..2285327)
Genome map
AA seq 309 aa AA seqDB search
MTTAPVTVRVPAKVNAQLAVGPLRADGFHDLANVFLAVGLYDEVTATPADALRITVSGPD
ADQVPLDSGNLAARAAEALAARHGRRADVHLHIAKDIPVAGGMAGGSADAAGALLACDTL
WGTGATRDELLDICAELGSDVPFSLVGGAALGRGRGELLEPLTVGGTFHWVFAVADGGLS
TPAVYRECDRLRQAAAVTVPAPEASPALLAALRTGDAAALAAAVGNDLQAAALSLRPCLA
DTLRTGTEAGALAALVSGSGPTCAFLAEDADAAARIGKALTASGTCRTARATTAPAPGAT
VVAPPTRRH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgcccccgtcaccgtccgcgttcccgccaaggtcaacgcgcagctcgccgtg
ggaccgctgcgcgccgacggcttccacgacctggccaacgtcttcctcgcggtcggcctg
tacgacgaggtcaccgccaccccggccgacgccctgcggatcaccgtctccggccccgac
gccgaccaggtgccgctggactccggcaacctcgccgcccgcgccgccgaggccctcgcc
gcccgccacggccgccgggccgacgtccatctgcacatcgccaaggacatcccggtggcc
ggcggcatggccggcggcagcgccgacgccgccggcgccctgctggcctgcgacacgctg
tggggcaccggcgccacccgcgacgaactcctcgacatctgcgccgagttgggcagcgac
gtccccttcagcctggtcggcggcgccgccctgggccgcggacgcggcgaactcctcgaa
cccctcaccgtcggcggcaccttccactgggtcttcgcggtcgccgacggcggcctgtcc
accccggccgtctaccgcgaatgcgaccggctgcgccaggccgccgccgtcaccgtcccc
gcccccgaggcgtcccccgccctgctggcggcgttgcgcaccggcgacgccgccgccctc
gccgccgccgtcggcaacgacctccaggccgccgcgctgtcgctgcgcccctgcctcgcc
gacaccctgcgcaccggcaccgaggccggcgccctcgccgccctcgtctccggctccggc
cccacctgcgccttcctggccgaggacgccgacgccgcggcccggatcggcaaggcgctc
accgcctccggcacctgccgcaccgcccgggccaccaccgcccccgcccccggagccacc
gtcgtcgccccgcccacccggcggcactag

DBGET integrated database retrieval system