KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_21770Help
Entry
SCATT_21770       CDS       T02095                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCATT_21770
   00052 Galactose metabolism
    SCATT_21770
   00500 Starch and sucrose metabolism
    SCATT_21770
   00520 Amino sugar and nucleotide sugar metabolism
    SCATT_21770
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCATT_21770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2331590..2332558)
Genome map
AA seq 322 aa AA seqDB search
MDIGRIFGVDHPASGYRAHMTLARPRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPA
IQYVVEEAVAAKLTDVLMVTGRNKRPLEDHFDRNYELEEALTRKGDDSRLARVQESTDLA
TVHYVRQGAPKGLGHAVLCAEPHVADQPFAVLLGDDLIDPRDPLLQRMIDAQERYGGSVV
ALMEVDPAQIHLYGCAAVEELPGDGDVVRVTDLVEKPSAADAPSAYAVIGRYVLDPGVFD
VLRQTPPGRGGEIQLTDALRVLADSEVPGGPVHGVLFSGRRYDTGDRADYLRAIVRLACE
REDLGPDFRSWLRRYVTEEMQP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggatatcggccggatttttggtgttgatcacccggccagcggttatcgtgcgcacatg
acactcgcgcgcccccggatcagcaaggctgtcatccccgccgccggtctcggcacccgg
ttcctgccggccaccaaggcgacccccaaggagatgctgccggtcgtggacaagccggcg
atccagtacgtcgtcgaggaggccgtggcagccaagctgaccgacgtcctgatggtcacc
ggccgcaacaagcgcccgctggaggaccacttcgaccgcaactacgagctggaggaggcg
ctcacccgcaagggcgacgactcccggctcgcccgggtgcaggagtccaccgacctggcc
accgtgcactacgtccgccagggcgcgcccaagggcctcggccacgccgtgctctgcgcc
gagccgcacgtggccgaccagccgttcgccgtcctcctcggcgacgacctgatcgacccc
cgcgatccgctgctccagcgcatgatcgacgcacaggaacgttacggcggcagtgtcgtc
gcgctgatggaggtcgatccggcccagatccacctgtacggctgcgcggccgtcgaggag
ctgcccggcgacggggacgtggtgcgggtgaccgatctggtggagaagcccagcgccgcc
gacgccccctccgcctacgcggtgatcggccgctacgtcctcgaccccggcgtcttcgac
gtgctccgccagaccccgcccggacgcggcggcgagatccagctcaccgacgccctgcgg
gtgctcgccgactccgaggtgcccggcggtccggtgcacggggtgctcttctcggggcgg
cgctatgacaccggcgaccgcgccgactatcttcgtgcgatcgtacgactcgcctgcgaa
cgcgaagacctggggcccgacttcaggtcctggcttcgccgttacgtcacggaggaaatg
caaccgtga

DBGET integrated database retrieval system