KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_24400Help
Entry
SCATT_24400       CDS       T02095                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_24400
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_24400
   00052 Galactose metabolism
    SCATT_24400
   00500 Starch and sucrose metabolism
    SCATT_24400
   00520 Amino sugar and nucleotide sugar metabolism
    SCATT_24400
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCATT_24400
   00524 Butirosin and neomycin biosynthesis
    SCATT_24400
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCATT_24400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2594408..2595301
Genome map
AA seq 297 aa AA seqDB search
MKGALVGPDGEPLHEERRPTERGRGPGAVVDSVLEFAAALRERGMRDHGEPAAAAGVAVP
GVVDDAAGVAVYSANIGWRDVPMRALLAERLGGVPVALGHDLRCGGLAEGRLGAGRGQDR
FLFLALGTGIAAAIGIDGRIEAGAHGYAGEIGHIVVRPGGRGCPCGQNGCLETESSASAV
ARDWAEASGDPEATAAGCAHAVAEGDPRALAVWRNAVDTLAAGLVTGLTLLDPRVIVIGG
GLAEAGETLFGPLRTAVAERVTFQKLPLIVPAALGDAAGCLGAGLLAWDRLSMEVTA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgccctggtcggtccggacggcgagccgttgcacgaggagcggcggccgacg
gagcgggggcgcgggccgggggccgtggtggactcggtgctggagttcgccgccgcgctg
cgggagcgcgggatgcgcgaccacggggagccggccgccgcggccggggtcgcggtgccg
ggggtggtggacgacgccgccggggtcgcggtgtactccgcgaacatcggctggcgtgac
gtgccgatgcgcgcgctcctcgccgagcggctcggcggcgttcccgtcgccctcggccac
gacctgcgctgcggcggcctcgccgagggccggctgggcgccgggcgcggccaggaccgt
ttcctgttcctggcgctcggcaccggtatcgccgccgcgatcggcatcgacggccggatc
gaggccggcgcccacggctacgcgggcgagatcggccacatcgtggtccgtccgggcggg
cgtggctgcccgtgcggccagaacgggtgcctggagacggagtcctccgcgtccgcggtc
gcccgcgactgggccgaggccagtggtgaccccgaggccaccgcggcggggtgcgcgcac
gccgtcgcggagggcgatccgcgcgcgctggcggtgtggcgcaacgccgtggacacgctg
gccgcgggtctggtgaccgggctgaccctgctggacccgcgggtgatcgtgatcggcggc
gggctggccgaggccggggagacgctcttcggcccgttgcggacggcggtcgcggagcgg
gtgacgttccagaagctgcccctgatcgttccggcggccctcggggacgctgccgggtgc
ctgggcgcggggctcctcgcctgggaccgactctccatggaggtaaccgcctga

DBGET integrated database retrieval system