KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_24400Help
Entry
SCATT_24400       CDS       T02095                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00010  Glycolysis / Gluconeogenesis
scy00052  Galactose metabolism
scy00500  Starch and sucrose metabolism
scy00520  Amino sugar and nucleotide sugar metabolism
scy00521  Streptomycin biosynthesis
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_24400
   00052 Galactose metabolism
    SCATT_24400
   00500 Starch and sucrose metabolism
    SCATT_24400
   00520 Amino sugar and nucleotide sugar metabolism
    SCATT_24400
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCATT_24400
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SCATT_24400
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCATT_24400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pilosulin HD_4
Motif
Other DBs
NCBI-ProteinID: AEW94811
UniProt: F8K037
Position
2594408..2595301
Genome map
AA seq 297 aa AA seqDB search
MKGALVGPDGEPLHEERRPTERGRGPGAVVDSVLEFAAALRERGMRDHGEPAAAAGVAVP
GVVDDAAGVAVYSANIGWRDVPMRALLAERLGGVPVALGHDLRCGGLAEGRLGAGRGQDR
FLFLALGTGIAAAIGIDGRIEAGAHGYAGEIGHIVVRPGGRGCPCGQNGCLETESSASAV
ARDWAEASGDPEATAAGCAHAVAEGDPRALAVWRNAVDTLAAGLVTGLTLLDPRVIVIGG
GLAEAGETLFGPLRTAVAERVTFQKLPLIVPAALGDAAGCLGAGLLAWDRLSMEVTA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgccctggtcggtccggacggcgagccgttgcacgaggagcggcggccgacg
gagcgggggcgcgggccgggggccgtggtggactcggtgctggagttcgccgccgcgctg
cgggagcgcgggatgcgcgaccacggggagccggccgccgcggccggggtcgcggtgccg
ggggtggtggacgacgccgccggggtcgcggtgtactccgcgaacatcggctggcgtgac
gtgccgatgcgcgcgctcctcgccgagcggctcggcggcgttcccgtcgccctcggccac
gacctgcgctgcggcggcctcgccgagggccggctgggcgccgggcgcggccaggaccgt
ttcctgttcctggcgctcggcaccggtatcgccgccgcgatcggcatcgacggccggatc
gaggccggcgcccacggctacgcgggcgagatcggccacatcgtggtccgtccgggcggg
cgtggctgcccgtgcggccagaacgggtgcctggagacggagtcctccgcgtccgcggtc
gcccgcgactgggccgaggccagtggtgaccccgaggccaccgcggcggggtgcgcgcac
gccgtcgcggagggcgatccgcgcgcgctggcggtgtggcgcaacgccgtggacacgctg
gccgcgggtctggtgaccgggctgaccctgctggacccgcgggtgatcgtgatcggcggc
gggctggccgaggccggggagacgctcttcggcccgttgcggacggcggtcgcggagcgg
gtgacgttccagaagctgcccctgatcgttccggcggccctcggggacgctgccgggtgc
ctgggcgcggggctcctcgcctgggaccgactctccatggaggtaaccgcctga

DBGET integrated database retrieval system