KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_26280Help
Entry
SCATT_26280       CDS       T02095                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2770258..2770848)
Genome map
AA seq 196 aa AA seqDB search
MSSDPTVQPVPASVEQQVDAADTTLHNPKWAVISLGSNLGNRMETLQGAVDALADTPGAR
VKAVSPVYETEPWGVEPGSQPNYLNAVVLMRTTLPPSSLLERAHAIEEAFVRVRDERWGP
RTIDVDIVSYQDVVSDDPTLTLPHPRAHERAFVLAPWHDVDPEAELPGHGPVDKLLAAAG
VEGVTRRADLELRLPE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccgaccccaccgtccagccggtccccgcctccgtcgaacagcaggtggacgcc
gcggacaccacgctgcacaaccccaaatgggcggtgatctcgctcggcagcaacctcggc
aaccgcatggagaccctccagggcgcggtggacgcgctggcggacaccccgggggcgcgc
gtcaaggccgtctcgccggtgtacgagacggagccgtggggcgtcgagccgggcagccag
cccaactacctcaacgcggtggtgctgatgcgcaccacgctgccgccctcctcgctgctg
gagcgggcgcacgccatcgaggaggcgttcgtccgggtccgcgacgagcgctggggaccg
cgcaccatcgacgtggacatcgtcagctaccaggacgtggtcagcgacgacccgacgctc
accctgccccacccgcgcgcccacgagcgggccttcgtgctggccccctggcacgacgtc
gacccggaggcggagctgcccggccacggcccggtggacaagctgctcgccgccgccggt
gtcgagggcgtcactcgccgtgcggatctggaactccggctgccggaatag

DBGET integrated database retrieval system