KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_26340Help
Entry
SCATT_26340       CDS       T02095                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCATT_26340
Enzymes [BR:scy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SCATT_26340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2776076..2776684)
Genome map
AA seq 202 aa AA seqDB search
MTDPVTLNDAGNAAGEFDEKRAENAVRELLLAVGEDPDREGLQETPARVARAYKEIFAGL
WQRPEDVLTTTFDLGHDEMVLVRDIEVYSTCEHHLVPFHGVAHVGYIPATTGKITGLSKL
ARLVDVYARRPQVQERLTTQIADSLMDILEPRGVIVVVECEHMCMSMRGIRKPGAKTTTS
AVRGQLRDPATRAEAMSLILAR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctgaacgacgcgggtaacgctgccggcgagttcgacgagaag
cgggccgagaacgccgtccgcgaactgctgctcgcggtcggcgaggacccggaccgggaa
ggcctccaggagacccccgcccgggtggcccgcgcctacaaggagatcttcgccgggctg
tggcaacgtccggaggacgtcctgaccaccaccttcgacctcggtcacgacgagatggtg
ctggtgagggacatcgaggtctactcgacctgtgagcaccacctggtgcccttccacggc
gtcgcgcacgtcggctacatcccggccaccaccggcaagatcaccgggctgtccaagctg
gcccggctggtggacgtctacgcccgccgcccccaggtccaggagcggctgaccacccag
atcgccgactcgctgatggacatcctggagccgcgcggcgtgatcgtggtcgtcgagtgc
gagcacatgtgcatgtcgatgcgggggatccgcaagccgggcgccaagaccaccacctcg
gccgtccgcggccagctgcgcgacccggccacccgcgccgaggcgatgagcctgatactg
gcccgctga

DBGET integrated database retrieval system