KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_28050Help
Entry
SCATT_28050       CDS       T02095                                 

Definition
O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
Enzymes [BR:scy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SCATT_28050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2948848..2950929)
Genome map
AA seq 693 aa AA seqDB search
MPPERWQQHNITFPDRDTARRAITERLAPALLAAEADGQLSGWWFMNKQPWPLRYVADRP
SPTMVALLDELVADGIALSCTLAIYEAETEAFGGANAMTAAHALFHEDSRHLLNYPVCAG
HLGRRETAVLLMSSLMRAANLDWFEQGDVWAKVAALRPGTDAPAPERSATLISAMRTLMT
TEARSLCREGGPFDGHAEWIAAFERAGTTLAYLAAQGDLTRGLRAVIAHHVIFHANRAGL
PSEDQHALSHIAREAVMGSSENTASAPAPGSAADSVSAVKTDTLTSAEADAEQLRNALVD
QIKANGHARTPAVEAALRAVPRHLFVPDASLTDAYANAPVNIKYDSEGTSISCASQPGIV
ALMLDQLDAQPGERILELGAGTGYNAALLGHLVGPTGHVTTIDVDDDLVEGARAHLAAAG
VTNVEALTRDGALGHAEGAPYDRIVATVGAHGIPHAWLDQLSPGGRLVTPQRLKGSVSRS
IIYEKHDGRWLSLGSEMNTFMPLRRGIADDDRRVVPLSADGTVRLQAPSGQLIDADALAG
VLDQPRVEQWTEMTVRAGESPEWMELFVSCAVPSGLVRMLFPQSAKGTVLTEDPYPSATA
AVEESTVTYLARRPSEQKTPEGGKLWEFGVIGHGPGSDQLAAKVADAIRTWDREYRGREA
TFEALPLDGPAVEQRPGTFVLDTPLNRILVAWQ
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgccccccgagcgctggcagcagcacaacatcaccttccccgaccgggacaccgcgcgt
cgcgccatcaccgaacgcctcgccccagcgctgctcgctgccgaggccgacgggcagctc
agcggctggtggttcatgaacaagcagccctggcccctgcggtacgtggccgaccggccg
tcgccgaccatggtggccctgctggacgaactggtggccgacggcatcgcgctgtcctgc
acgctcgcgatctacgaggcggagaccgaggcgttcggcggcgcgaacgccatgacggcc
gcgcacgccctcttccacgaggacagccgtcatctcctcaactacccagtttgcgccggg
catctggggcgccgcgagaccgccgtcctgctgatgagcagcctgatgcgcgccgcgaac
ctcgactggttcgagcagggcgacgtgtgggcgaaggtcgccgcgctgcgtcccggcacc
gacgcccctgcacccgagcgctccgccacgctgatctcggcgatgcggaccctgatgacc
acggaggcccgcagcctgtgccgcgagggcgggccgttcgacggccacgccgagtggatc
gccgccttcgagcgcgccggaaccacgctggcctacctcgccgcccagggcgatctgacc
cgcgggctgcgggccgtcatcgcgcatcacgtgatcttccacgccaaccgtgccggtctg
ccatccgaagaccagcacgccctgtcccacatcgcacgagaggcagtcatgggatcgagt
gaaaacaccgcgtcagcaccagcgccaggctccgcggccgatagcgtcagcgcggtgaaa
accgacacactcacctccgccgaggccgacgccgaacagctccgcaacgccctggtggac
cagatcaaggccaacggccacgcccgcactcccgcggtcgaagccgctctgcgcgccgtg
cccaggcacctgttcgtccccgacgcctcgctgaccgatgcctacgccaacgcgccggtc
aacatcaagtacgacagcgagggcacgtccatctcctgcgcctcccaaccaggcatcgtc
gccctcatgctggaccagctcgacgcccagcccggcgaacgcatcctcgaactcggcgcc
ggcactggctacaacgccgccctgctcggccacctcgtcggccccaccggacacgtcacc
accatcgacgtcgatgacgacctggtcgagggcgcccgcgcccacctcgccgccgccggc
gtcaccaacgtcgaggccctgacccgcgacggcgccctcggccacgccgaaggcgccccg
tacgaccggatcgtcgccaccgtcggcgcgcacggcatcccccacgcctggctcgaccag
ctctcccccggcgggcggctcgtcaccccgcagcggctcaagggcagcgtctcgcgctcc
atcatctacgagaagcacgacggccggtggctgtcgctcggctcggagatgaacaccttc
atgccgctgaggcggggcatcgccgacgatgaccgccgcgttgtcccgctcagcgcggac
ggcaccgtgcggctccaggccccttccggacaactcatcgatgcagacgccctcgcgggt
gtcctcgaccagccgcgcgtcgagcagtggaccgagatgacggtccgcgcaggagagtcg
ccggagtggatggagctgttcgtctcctgcgcggtgccctccggcctggtccggatgctc
ttcccccagtccgccaagggcacggtgctcaccgaggacccatacccctcggccacggcc
gccgtcgaggagagcaccgtcacctacctcgcccgccggccttccgagcagaagaccccc
gagggcggcaagctctgggagttcggcgtcatcggccacggccccggtagcgaccagctg
gccgcgaaggtcgccgacgccatccgcacctgggaccgcgagtatcgcggccgggaggcc
accttcgaggccctgccgctcgacggacccgcggtcgagcagcggcccggcactttcgtc
ctcgacaccccgttgaaccgcatcctcgtcgcctggcagtag

DBGET integrated database retrieval system