KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_34140Help
Entry
SCATT_34140       CDS       T02095                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:scy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3634993..3635964
Genome map
AA seq 323 aa AA seqDB search
MVRPRRLRTTPAMRRMVAETRLHPADLILPAFVREGIDEPVAIGSMPGVYQHTRDSLRKA
AAEAVAAGVGGIMLFGVPLHKDATGSQGTDPDGILQVAIRDVKAEVGDDLVIMSDLCLDE
FTDHGHCGVLDERGRVDNDATLERYAQMARVQADAGVHVVGPSGMMDGQVRVVRAALDAA
GHQDVSILAYTAKYASAFYGPFREAVNSSLRGDRKTYQQDPANARESLRELELDLAEGAD
MVMVKPALPYLDILRQIADAVDVPVAAYQISGEYAMVEAAAANGWIDRDRAIMETLTGIR
RAGAGMVLTYWATEAALRLRRGE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggtccggccgcggcggctgcggaccaccccggcgatgcgccggatggtggcggagacg
cggctgcacccggccgatctgatcctgcccgccttcgtgcgggagggcatcgacgagccg
gtggccatcggttcgatgccgggggtgtaccagcacacccgggactcgctgcgcaaggcg
gcggccgaggcggtggcggccggggtgggcggcatcatgctcttcggggtgccgctgcac
aaggacgcgaccggctcccagggcaccgacccggacggcatcctccaggtggcgatcagg
gacgtgaaggccgaggtcggcgacgacctggtgatcatgtccgatctgtgtctggacgag
ttcaccgaccacggtcactgcggggtgctggacgagcgcggccgggtggacaacgacgcc
acgctggagcggtacgcgcagatggcccgggtccaggcggacgcgggggtgcacgtggtg
ggccccagcggcatgatggacggccaggtacgggtggtccgcgccgcgctggacgccgcc
ggccaccaggacgtgtcgatcctggcgtacaccgccaagtacgcgtcggcgttctacggc
ccgttccgcgaggcggtcaactcctcgctgcgcggggaccgtaagacgtaccagcaggat
ccggccaatgcgcgcgagtcgctgcgcgagctggagctggacctggccgagggcgccgac
atggtgatggtcaagcccgccctgccgtatctggacattctgcggcagatcgccgacgcg
gtggacgtgccggtggcggcgtaccagatctccggcgagtacgcgatggtggaggcggcg
gcggccaacggctggatcgaccgggaccgggcgatcatggagacgctgaccgggatccgg
cgggccggcgcgggcatggtgctgacctactgggcgaccgaggcggcgctgcggttgcgt
cgcggggagtga

DBGET integrated database retrieval system