KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_36640Help
Entry
SCATT_36640       CDS       T02095                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SCATT_36640
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SCATT_36640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3946083..3947939
Genome map
AA seq 618 aa AA seqDB search
MSEEPHGQGPAAAGEDPSHQARPDDGHDGDDRYDYDVIVVGSGFGGSVAALRLTEKGYRV
GVLEAGRRFARGTLPKNSWRVRDYLWAPALGLYGIQRIHLLGNVLVLAGAGVGGGSLNYA
NTLYVPPEPFFTDRQWGEITDWREELAPYYDQARRMLGVRLNPTMTPSDVHLKAAAERMG
VGETFHLAPVGVFFGDGEDADGTVTARPGEEVPDPYFGGAGPARRACVQCGECMTGCRHG
AKNTLTENYLYLAERAGAVIHPMTTVVGVTEDGSGGHLVATVPTDRRRGTRPSVLRARQV
VLAAGTYGTQTLLHAMRDRGDLPRLSPRLGELTRTNSEALVGAQTDDRRYRAAHGEPRAD
FTRGVAITSSIHPNDTTHIEPVRYGKGSNAMGALSVLQVPYGGRAPRWAQFLAHSAKHPW
LALRSLSNRRWSERTIIGLVMQTADNSLTTYRRRKGPGKGLLTARQGHGAPNPTHIPEGA
EAARVLAEEINGFPGSSIGEIADIPMTAHFLGGCPIGADPDHGVIDPYHRLHGHPGIHVV
DGSAVSANLGVNPSLTITAQAERAMALWPNKGDHDPRPAQGTPYQRVAPVTPRRPAVPKE
AFAALVLPVPKVPARPEG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaggaaccgcacgggcaggggccggccgccgccggcgaggacccgagccatcag
gcgcgccccgacgacggccacgacggggacgaccgctacgactacgacgtgatcgtcgtc
ggctccgggttcggcgggtcggtcgccgcgctgcggctgaccgagaaggggtaccgggtc
ggggtgctggaggccggccgccggttcgcccgcggaacgctgccgaagaactcctggcgg
gtgcgcgactacctgtgggcgcccgccctcgggctctacggcatccagcggatccacctg
ctgggcaacgtcctggtgctggccggcgccggggtgggcggcggctcgctcaactacgcc
aacaccctctacgtcccgccggaaccgttcttcaccgaccgccagtggggggagatcacc
gactggcgcgaggagttggcgccctactacgaccaggccagacggatgctgggggtgcgg
ctcaacccgacgatgaccccttccgacgtccatctgaaggcggcggccgagcggatgggg
gtgggcgaaacgttccatctggcgccggtcggggtcttcttcggcgacggcgaggacgcc
gacggcacggtgaccgcccgccccggcgaggaggtgcccgacccctacttcggcggcgcg
ggaccggcccggcgcgcctgcgtccagtgcggcgagtgcatgaccggctgccgccacggc
gccaagaacacgctcaccgagaactacctgtacctcgccgagcgggccggcgccgtcatc
cacccgatgaccaccgtcgtcggggtcaccgaggacggctccggcggccatctggtggcc
accgtccccaccgaccggcggcgcggcacccggcccagcgtgctgcgggcccgtcaggtc
gtcctcgcggccggcacctacggcacccagacgctgctgcacgccatgcgcgaccggggc
gacctgccgcgcctgtcgccccggctcggcgagctgacccgcaccaactccgaggcgctg
gtgggcgcccagaccgacgaccgccgctaccgcgcggcgcacggcgagccccgggccgac
ttcacccggggcgtcgccatcacctcctccatccaccccaacgacaccacgcacatcgag
ccggtccgctacggcaagggctccaacgccatgggcgcgctctccgtgctccaggtcccg
tacggcggacgggcgccgcgctgggcgcagttcctcgcccacagcgccaaacacccctgg
ctggcgctgcgttcactgtccaaccggcgctggtcggaacggaccatcatcggcctggtg
atgcagaccgccgacaactcgctgaccacgtaccgccggcgcaagggccccggcaaggga
cttctgacggcacgtcagggacatggggcgcccaaccccacccacatacccgagggcgcc
gaggcggcccgggtgctcgccgaggagatcaacggcttccccggcagcagcatcggcgag
atcgcggacatccccatgaccgcccacttcctcggcggctgccccatcggcgccgacccc
gaccacggcgtcatcgacccctaccaccggctccacggccaccccggcatccacgtggtg
gacggctccgcggtctccgccaacctcggcgtcaacccctccctgaccatcacggcccag
gcggaacgggcgatggcgctgtggcccaacaagggcgaccacgacccccgccccgcccag
ggcaccccctaccagcgcgtcgccccggtgaccccgcgccgccccgcggtgccgaaggag
gcgttcgccgcgctggtcctgccggtccccaaggtgccggcgcggccggaggggtga

DBGET integrated database retrieval system