KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_36920Help
Entry
SCATT_36920       CDS       T02095                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_36920
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCATT_36920
   00640 Propanoate metabolism
    SCATT_36920
   00660 C5-Branched dibasic acid metabolism
    SCATT_36920
Enzymes [BR:scy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SCATT_36920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3978821..3979993
Genome map
AA seq 390 aa AA seqDB search
MDLFEYQARDLFAKHDVPVLSGEVIDTPEAAREVAERLGGRVVVKAQVKTGGRGKAGGVK
LADGPDDAVEKAGAILGMDIKGHTVHKVMLAQTADIVDEYYVSFLLDRANRTFLAMASVE
GGMEIEEVAATKPEALAKVPVDAKEGVTDAKAREIVEAAKFPAEVADQVAEVLKKLWTVF
IKEDALLVEVNPLAKTGDGTVLAIDGKVSLDANAAFRQPDHAELEDKASANPLEAAAKAK
GLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGNVKPANFLDIGGGASAEVMANGLE
IILGDPAVKSVFVNVFGGITACDAVANGIVQALELLKSKGEDVNKPLVVRLDGNNAELGR
KILTDANHPLVQQVDTMDDAADRAAELAAK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaagcgagggatctcttcgccaagcacgatgtaccggtgctg
agcggtgaagtcatcgacacgccggaggccgcgcgcgaggttgccgagcgtctcggcggc
cgtgtggtcgtcaaggcgcaggtcaagaccggtggccgcggcaaggccggcggcgtgaag
ctggccgacggcccggacgacgcggtggagaaggccggcgccatcctgggcatggacatc
aagggccacacggtccacaaggtgatgctggcccagaccgcggacatcgtggacgagtac
tacgtctcgttcctgctggaccgtgccaaccggacgttcctcgccatggcctccgtcgag
ggcggcatggagatcgaggaggtggccgccaccaagccggaggcgctcgccaaggtcccg
gtggacgccaaggagggcgtgaccgacgccaaggcccgcgagatcgtcgaggccgccaag
ttcccggccgaggtcgccgaccaggtcgccgaggtcctcaagaagctgtggaccgtcttc
atcaaggaagacgccctgctggtcgaggtcaacccgctggcgaagaccggtgacggcacg
gtgctggcgatcgacggcaaggtgtcgctggacgccaacgccgccttccggcagccggac
cacgccgagctggaggacaaggcttccgccaacccgctggaggccgccgccaaggccaag
ggcctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggcctg
gtcatgtcgaccctggacgtcgtcgcctacgccggcgagaagcacggcaacgtcaagccg
gccaacttcctggacatcggcggcggcgcctccgccgaggtgatggccaacggtctggag
atcatcctgggcgacccggccgtcaagtcggtcttcgtcaacgtcttcggcggcatcacc
gcgtgcgacgcggtcgccaacggcatcgtccaggccctggagctgctcaagtccaagggc
gaggacgtcaacaagccgctggtcgtgcgtctggacggcaacaacgccgagctgggccgc
aagatcctcaccgacgccaaccacccgctggtgcagcaggtggacaccatggatgacgcg
gcggaccgcgccgccgagctggctgctaagtaa

DBGET integrated database retrieval system