KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_37480Help
Entry
SCATT_37480       CDS       T02095                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00020  Citrate cycle (TCA cycle)
scy00190  Oxidative phosphorylation
scy00650  Butanoate metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01200  Carbon metabolism
Module
scy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
scy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
scy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCATT_37480
   00650 Butanoate metabolism
    SCATT_37480
  Energy metabolism
   00190 Oxidative phosphorylation
    SCATT_37480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEW96119
UniProt: F8K0D3
Position
complement(4036706..4037188)
Genome map
AA seq 160 aa AA seqDB search
MSAETSVDSVELTSTSTGAHSPENPAPVIEPARARSKRSPRATRTNFEMYGWLFMRLSGI
VLVVLVLGHLLIQLVLDGGVSKIGFAFVAGRWANPFWQLWDLAMLWLAMLHGANGLRTVI
NDYAERESTRMWLKGLLYTATVFTVFLGTLVIFTFDPNIQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgagacctctgtcgactcggtggagctgacctccaccagcacgggcgcccac
agcccggagaaccccgcgcccgtcatcgagccggcgcgtgcccgtagcaagcgcagcccg
cgggcgacccgcaccaacttcgagatgtacggctggctgttcatgcggctgtccggcatc
gtcctggtggtcctggtcctcgggcacctgctgatccagctggtgctggacggcggcgtg
agcaagatcggcttcgccttcgtggccggccgctgggccaacccgttctggcagctgtgg
gacctggccatgctgtggctggccatgctgcacggcgccaacggcctgcggacggtcatc
aacgactacgccgagcgggagtccacccgcatgtggctgaaggggctgctgtacacggca
accgtcttcaccgttttcctcggcacgctggtgatcttcaccttcgacccgaacatccag
tag

DBGET integrated database retrieval system