KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_37480Help
Entry
SCATT_37480       CDS       T02095                                 

Definition
Succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_37480
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCATT_37480
   00650 Butanoate metabolism
    SCATT_37480
  Energy metabolism
   00190 Oxidative phosphorylation
    SCATT_37480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4036706..4037188)
Genome map
AA seq 160 aa AA seqDB search
MSAETSVDSVELTSTSTGAHSPENPAPVIEPARARSKRSPRATRTNFEMYGWLFMRLSGI
VLVVLVLGHLLIQLVLDGGVSKIGFAFVAGRWANPFWQLWDLAMLWLAMLHGANGLRTVI
NDYAERESTRMWLKGLLYTATVFTVFLGTLVIFTFDPNIQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgagacctctgtcgactcggtggagctgacctccaccagcacgggcgcccac
agcccggagaaccccgcgcccgtcatcgagccggcgcgtgcccgtagcaagcgcagcccg
cgggcgacccgcaccaacttcgagatgtacggctggctgttcatgcggctgtccggcatc
gtcctggtggtcctggtcctcgggcacctgctgatccagctggtgctggacggcggcgtg
agcaagatcggcttcgccttcgtggccggccgctgggccaacccgttctggcagctgtgg
gacctggccatgctgtggctggccatgctgcacggcgccaacggcctgcggacggtcatc
aacgactacgccgagcgggagtccacccgcatgtggctgaaggggctgctgtacacggca
accgtcttcaccgttttcctcggcacgctggtgatcttcaccttcgacccgaacatccag
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system