KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_37740Help
Entry
SCATT_37740       CDS       T02095                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:scy00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4063797..4065074
Genome map
AA seq 425 aa AA seqDB search
MDVISVIRTKRDRGRLTDEQIDWVIDAYTRGEVADEQMSALAMAILLNGMDRAEIARWTA
AMIASGERMEFSSLPRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRALLSNDEMMGVLRDVGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGSLVLDVKVGSGAFMKTVADARELATTMVGLGTDHGVRTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPADVVELTLALAREMLDAAGLPDADPAKALRDGTAM
DHWRRMISAQGGDPDAPLPVARERHVVTAPATGVLTGLDAYAVGVAAWRLGAGRSRKEDP
VQAGAGVELHAKPGDQVTAGRPLLTLHTDTPERFDYALQALDGAVTVAPAGTPFTPRPIV
LERIG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatctccgtcatccgcaccaagcgcgaccgcggccggctgaccgacgagcag
atcgactgggtgatcgacgcctacacccgcggcgaggtcgccgacgagcagatgtcggcg
ctggccatggccatcctgctcaacggcatggaccgggccgagatcgcgcgctggacggcg
gcgatgatcgcctccggcgagcggatggagttctcctcgctgccccggcccaccgccgac
aagcactccaccggcggcgtcggcgacaagatcacgctgccgctggccccgctggtggcc
gcgtgcggcgccgccgtaccgcagctgtccggccgcggcctcggccacaccggcggcacc
ctggacaagctggagtcgatccccggctggcgggcgctgctgtccaacgacgagatgatg
ggcgtcctgcgtgacgtgggcgccgtcatctgcgcggccggcgacggactggccccggcc
gacaagaagctctacgcgctgcgcgacgtcaccggcaccgtcgaggcgatcccgctgatc
gccagctccatcatgagcaagaagatcgccgagggcaccggctcgctggtgctcgacgtc
aaggtgggcagcggcgccttcatgaagaccgtggccgacgcgcgcgagctggccaccacc
atggtgggcctcggcaccgaccacggggtgcgcaccgtcgcgctgctgaccgacatgtcg
accccgctcggcctgaccgcgggcaacgcgctggaggtccgcgagtcggtcgaggtgctg
gccggcggcggccccgccgacgtcgtcgaactcaccctggcgctcgcccgcgagatgctg
gacgcggccgggctgcccgacgccgacccggccaaggcgctgcgcgacggcaccgcgatg
gaccactggcgccgcatgatcagcgcgcagggcggcgaccccgacgcgccgctgccggtg
gcccgcgaacgccacgtggtcaccgcccccgccaccggcgtcctcaccgggctggacgcc
tacgccgtcggcgtcgccgcctggcggctgggcgccggccgctcccgcaaggaggacccg
gtccaggccggcgccggcgtcgaactccacgccaagcccggcgaccaggtcaccgccggc
cggccgctgctcaccctgcacaccgacacccccgagcgcttcgactacgccctccaggcg
ctcgacggcgccgtcaccgtcgccccggccggcacccccttcaccccgcgcccgatcgtg
ctggagcggatcggctga

DBGET integrated database retrieval system