KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_39070Help
Entry
SCATT_39070       CDS       T02095                                 

Definition
(GenBank) putative polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00010  Glycolysis / Gluconeogenesis
scy00520  Amino sugar and nucleotide sugar metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
scy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_39070
   00520 Amino sugar and nucleotide sugar metabolism
    SCATT_39070
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SCATT_39070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEW96278
UniProt: G8WSP3
Position
complement(4195493..4196242)
Genome map
AA seq 249 aa AA seqDB search
MDIGGSGIKGAPVDLGRGELAGERFKVLTPHPSEPAAVVAGVRQVVGHFGWSGPVGVTFP
GVVTDGVTRTAANMHPDWVDVDARALLSEALGVPVTVRNDADAAGLAEMRFGAGRGHDGT
VIVLTFGTGIGSAVFHRGRLLPNTELGHLELHGHDAEKRAAARVKDDHGMSWPQWAARVE
EYLAEVEKLFSPELLVLGGGVSRKAEKFLPLLRGVRAKIVPARLHNEAGIVGAAMEAAAE
HAGAGTGTA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcggcggctccgggatcaagggcgccccggtcgatctcggccggggcgagctg
gcgggggaacggttcaaggtgctgaccccgcatccgtccgagccggccgccgtggtggcc
ggggtgcgtcaggtcgtcgggcatttcggctggtcgggaccggtcggggtgaccttcccc
ggtgtcgtcacggacggggtcacccgtaccgcggccaacatgcaccccgactgggtggac
gtggacgcgcgggcgctgctctccgaggcgctgggcgtgccggtcacggtgcgcaacgac
gcggacgccgccggactggccgagatgcggttcggggcgggccggggccacgacggcacc
gtcatcgtgctcaccttcggcaccggcatcggcagcgcggtcttccaccggggccggctg
ctgcccaacaccgagctgggccatcttgagctgcacggccacgacgcggagaagcgggcc
gccgcgcgggtcaaggacgaccacggcatgagctggccgcagtgggcggcgcgggtcgag
gagtacctggccgaggtggagaagttgttctcgcccgagctgctggtgctcggcggcggg
gtcagccgcaaggcggagaagttcctgccgctgctcaggggggtgcgcgcgaagatcgtc
ccggcgcggttgcacaacgaggccgggatcgtcggggccgcgatggaggcggcggccgag
cacgcgggcgcggggaccggcacggcctga

DBGET integrated database retrieval system