KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_39070Help
Entry
SCATT_39070       CDS       T02095                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:scy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scy00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scy00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4195493..4196242)
Genome map
AA seq 249 aa AA seqDB search
MDIGGSGIKGAPVDLGRGELAGERFKVLTPHPSEPAAVVAGVRQVVGHFGWSGPVGVTFP
GVVTDGVTRTAANMHPDWVDVDARALLSEALGVPVTVRNDADAAGLAEMRFGAGRGHDGT
VIVLTFGTGIGSAVFHRGRLLPNTELGHLELHGHDAEKRAAARVKDDHGMSWPQWAARVE
EYLAEVEKLFSPELLVLGGGVSRKAEKFLPLLRGVRAKIVPARLHNEAGIVGAAMEAAAE
HAGAGTGTA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcggcggctccgggatcaagggcgccccggtcgatctcggccggggcgagctg
gcgggggaacggttcaaggtgctgaccccgcatccgtccgagccggccgccgtggtggcc
ggggtgcgtcaggtcgtcgggcatttcggctggtcgggaccggtcggggtgaccttcccc
ggtgtcgtcacggacggggtcacccgtaccgcggccaacatgcaccccgactgggtggac
gtggacgcgcgggcgctgctctccgaggcgctgggcgtgccggtcacggtgcgcaacgac
gcggacgccgccggactggccgagatgcggttcggggcgggccggggccacgacggcacc
gtcatcgtgctcaccttcggcaccggcatcggcagcgcggtcttccaccggggccggctg
ctgcccaacaccgagctgggccatcttgagctgcacggccacgacgcggagaagcgggcc
gccgcgcgggtcaaggacgaccacggcatgagctggccgcagtgggcggcgcgggtcgag
gagtacctggccgaggtggagaagttgttctcgcccgagctgctggtgctcggcggcggg
gtcagccgcaaggcggagaagttcctgccgctgctcaggggggtgcgcgcgaagatcgtc
ccggcgcggttgcacaacgaggccgggatcgtcggggccgcgatggaggcggcggccgag
cacgcgggcgcggggaccggcacggcctga

DBGET integrated database retrieval system