KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_39800Help
Entry
SCATT_39800       CDS       T02095                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00300  Lysine biosynthesis
scy01100  Metabolic pathways
scy01120  Microbial metabolism in diverse environments
scy01230  Biosynthesis of amino acids
Module
scy_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCATT_39800
Enzymes [BR:scy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SCATT_39800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEW96351
UniProt: F8K3N0
Position
4275681..4276748
Genome map
AA seq 355 aa AA seqDB search
MSIPVLDLSQDAVGVTAQLVDIPSVSRDEQVLADAVEQALRALPHLTVERDGNAVVARTA
LGRAERVVLAGHLDTVPVAGNLPSRLTDGVLHGCGTSDMKSGVAVQLRLAATVPAPNRDL
TFVFYDAEEIAAEFNGLKRLAEHRPEWLAGDFAVLLEPTSAQVEGGCQGTMRVRVETTGR
RAHSARSWLGENAIHAAAPVLARLAAYTPRQVEIDGLTYREGLNAVLIEGGHAGNVIPDA
CAVTVNYRFAPDRGEREALAHVREVFDGFTVVLTDSAPGALPGLSHPAAAAFTAAVGGEP
AAKAGWTDVARFAALGIPAVNYGPGDPKLAHTREEHVRTADVLACEERLRRWLTG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccccgtactcgatctcagccaggacgcggtgggcgtgaccgcgcagctcgtc
gacatcccctcggtcagccgcgacgagcaggtgctcgcggacgccgtggaacaggcgttg
cgcgccctgccacacctgaccgtggaacgggacgggaacgcggtggtggcccgcaccgcg
ctcgggcgcgccgaacgcgtggtgctcgccggccacctggacaccgtgccggtcgccggc
aacctgccgtcccggctgaccgacggcgtgctgcacggctgcggcacctccgacatgaag
tccggggtcgccgtccagctccggctggccgccaccgtgcccgcccccaaccgcgacctg
accttcgtcttctacgacgccgaggagatcgccgcggagttcaacgggctgaagcggctc
gccgaacaccgtcccgaatggctcgccggcgacttcgcggtgctgctggagcccacctcc
gcccaggtcgaagggggctgccagggcaccatgcgggtacgggtggagaccaccggccgg
cgcgcccactccgcgcgcagctggctcggcgagaacgccatccacgccgccgcccccgtc
ctcgcccggctcgccgcctacaccccgcgccaggtcgagatcgacgggctcacctaccgc
gaggggctcaacgcggtgctgatcgagggcggccacgcgggcaacgtcatcccggacgcc
tgcgcggtcaccgtcaactaccgcttcgcgccggaccgcggcgagcgggaggcgctcgcc
cacgtccgggaggtcttcgacggcttcaccgtggtgctcaccgactccgcccccggcgcg
ctgcccggactgagccacccggccgccgccgccttcaccgccgcggtgggcggcgaaccc
gccgccaaggccggctggaccgacgtggcccgcttcgccgcgctcggcatcccggccgtc
aactacggccccggcgacccgaagctggcccacacccgcgaggagcacgtgcgcaccgcc
gacgtcctggcctgcgaggaacggctgcgtcgctggctcaccggctga

DBGET integrated database retrieval system