KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_39820Help
Entry
SCATT_39820       CDS       T02095                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCATT_39820
Enzymes [BR:scy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SCATT_39820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4277732..4278592)
Genome map
AA seq 286 aa AA seqDB search
MLRLGKREFGDHEPVIMAIVNRTPDSFYDQGATFADEAALARVDRAVAEGAAIIDIGGVK
AGPGEEVTTEEEIRRIVPFVAEVRERHPDVVISVDTWRHEVGEAVCAVGADLLNDAWGGV
DPHLAEVAARHRVGLVCTHAGGAEPRTRPHRVGYEDVMADILRVTLGLAQRAAELGVPRD
AILIDPGHDFGKNTRHSLEATRRLGEMVGTGWPVLVSLSNKDFVGETLDRPVKERLLGTL
ATTAVSAWLGARVYRVHEVAETRQVLDMVASIAGHRPPAVARRGLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgggcaagcgcgaattcggcgatcacgagccggtgatcatggcgatcgtg
aaccgtaccccggactccttctacgaccaaggtgccaccttcgccgacgaggcggcgctg
gcccgggtcgaccgggcggtcgccgagggggccgccatcatcgacatcggcggggtgaag
gccggacccggcgaggaggtcaccaccgaggaggagatccgccggatcgtgcccttcgtc
gccgaggtccgcgagcgccacccggacgtggtgatcagcgtggacacctggcgccacgag
gtcggcgaggcggtctgcgcggtcggcgccgacctgctcaacgacgcctggggcggggtc
gatccgcacctcgccgaggtcgccgcccggcaccgggtggggctggtgtgcacccacgcc
ggcggcgccgagccgcggacccgcccgcaccgggtggggtacgaggacgtgatggccgac
atcctgcgggtgacgctgggcctggcgcagcgggcggccgaactgggggtgccgcgggac
gccatcctgatcgacccggggcacgacttcggcaagaacacccggcactcgctggaggcg
acccggcggctcggcgagatggtgggcaccggctggccggtgctggtgtccttgtccaac
aaggacttcgtcggcgagacgctggaccgcccggtcaaggagcggctgctgggcacgctg
gccaccaccgcggtctcggcgtggctgggggcccgggtctaccgggtgcacgaggtcgcc
gagacccggcaggtgctcgacatggtggcctccatcgccggccaccggccccccgcggtg
gcccgcagggggctggcctga

DBGET integrated database retrieval system