KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_40850Help
Entry
SCATT_40850       CDS       T02095                                 

Definition
sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scy00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:scy00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4383498..4385024
Genome map
AA seq 508 aa AA seqDB search
MTTTAPATLTRDALAVLQPGFTGTTPPDWVLRRLGEGLGSVALFARNIESPEQVTALTAR
LRAESPELIVAADEEGGDVTRLEASTGSSFPGNHALGAVDDPGLTRAVARELGRRLAACG
VNLDWAPSADVNSDPGNPVIGVRSFGADPALVARHTAAYVQGLQEAGVAACTKHFPGHGD
TDVDSHHDLPRVDADLATLHARELVPFRAAVAAGSKAVMSAHILLPALDPDLPATLSPAA
LTGLLRAPADRGGLGFDGLIATDAVEMAAISARYGIERGTVLALAAGADAICVGGGLADE
GTVLRLRDALVAAVRGGELAEERLADAAARVRALGAWARRQAGAAVAADPEIGLTAARRA
LRITRAGEPPAPGGPVHVAALTPVANIAVGDVTPWGVGAELARLLPGTATATYREADLAA
SGLPALVANVLRSAADRRIVIVVRDIHRHRWMADTVHALLAARPDAVVVEMGVPQAPPLG
ALHIATHGAARVCGRAAAEVIAGKDAGR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacggcgcccgccaccctcacccgcgacgcgctcgccgtcctccagcccggc
ttcaccggcaccaccccgcccgactgggtgctgcgccggctcggcgaggggctgggctcg
gtcgccctgttcgcccgcaacatcgaaagccccgagcaggtgaccgcgctcaccgcccgg
ctgcgcgccgagtccccggagctgatcgtggcggccgacgaggagggcggcgacgtcacc
cggctggaggcttccaccggctcctccttccccggcaaccacgccctcggcgcggtggac
gaccccgggctgacccgggcggtcgcccgcgaactcggccgccggctcgccgcgtgcggg
gtcaacctcgactgggcgccctccgccgacgtcaactccgaccccggcaaccccgtcatc
ggggtgcgctccttcggcgccgaccccgcgctggtcgcccggcacaccgccgcctacgtc
caggggctccaggaggccggggtggccgcctgtaccaagcacttccccggccacggcgac
accgacgtcgactcccaccacgacctgccgcgcgtcgacgccgacctggccacgctgcac
gcccgcgaactggtcccgttccgcgccgcggtggccgccgggagcaaggccgtgatgagc
gcccacatcctgctccccgcgctcgaccccgacctgcccgccacgctcagcccggccgcc
ctgaccggtctgctgcgcgcccccgccgaccgcggcggcctcggcttcgacgggctgatc
gccaccgacgcggtggagatggccgccatctcggcccgttacggcatcgaacgcggcacc
gtgctggcgctcgccgcgggcgccgacgccatctgcgtgggcggcggcctcgccgacgag
gggacggtgctgcggctgcgggacgccctggtggccgcggtacgcggcggtgagctggcc
gaggagcgcctcgccgacgccgccgcccgggtccgcgcgctgggcgcctgggcccgccgc
caggccggcgccgcggtggccgccgacccggagatcgggctcaccgcggcccgccgggca
ctgcggatcacccgggccggggagcctccggcgcccggcggaccggtccacgtggccgcc
ctcaccccggtggccaacatcgcggtgggcgacgtgacgccgtggggggtcggcgccgag
ctggcccggctgctgcccgggacggccaccgccacgtaccgggaggccgacctggcggca
agcggtctgcccgccttggtggcaaatgtgctccggtcggcggcggaccgtaggatcgtc
atcgtggttcgcgacatccaccggcaccggtggatggctgacaccgtgcacgccctgctg
gccgccaggccggatgccgtcgtcgtggagatgggcgtgccgcaggcacctccgctcgga
gcgctgcacatcgcgacccacggcgcggcgcgcgtgtgcgggcgggcagccgcggaagtc
atcgccggcaaggacgccggtcgctga

DBGET integrated database retrieval system