KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_41640Help
Entry
SCATT_41640       CDS       T02095                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00260  Glycine, serine and threonine metabolism
scy00750  Vitamin B6 metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01230  Biosynthesis of amino acids
Module
scy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCATT_41640
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCATT_41640
Enzymes [BR:scy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCATT_41640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACP_syn_III_C PK_C
Motif
Other DBs
NCBI-ProteinID: AEW96535
UniProt: G8X0E1
Position
4469780..4470868
Genome map
AA seq 362 aa AA seqDB search
MNAVASPRMSGTHQWRGIIEEYRDRLPVTAETPVVTLLEGGTPLVPAQLLSERTGCDVHL
KVEGANPTGSFKDRGMTMAITRAKEEGAQAVICASTGNTSASAAGYAVRAGMVCAVLVPQ
GKIALGKMGQALVHGARILQVDGNFDDCLELARGLSDKYPVALVNSVNPVRIEGQKTAAF
EIVDALGDAPDIHVLPVGNAGNITAYWKGYREYAADGVSTRTPRMWGFQASGAAPIVKGE
PVRDPQTIATAIRIGNPASWAFAEAARDESGGLIEAVTDRQILAAYRLLAAREGVFVEPA
SAASVAGLLKAAEEGRLDPGQRVVCTVTGNGLKDPDWAVAGAPQPITVPVDADAAAERLG
LV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcgcttcacctcgaatgtccggcacccaccagtggcggggcatcatcgag
gagtaccgggaccggcttccggtgaccgccgagacccccgtggtcacgctgctggagggt
ggcaccccgctcgttcccgcccagctgctgtccgaacggaccggctgtgacgtccacttg
aaggtcgagggggccaaccccaccggttccttcaaggaccgcggcatgacgatggccatc
acccgggccaaggaggagggcgcccaggcggtcatctgcgcctccaccggcaacacctcg
gcctcggccgccgggtacgcggtacgggccgggatggtctgcgcggtgctggtgccgcag
ggcaagatcgcgctgggcaagatgggccaggcgctggtgcacggcgcccggatcctccag
gtcgacggcaacttcgacgactgcctggagctggcccgcgggctgagcgacaagtacccg
gtggcgctggtcaactcggtcaacccggtgcgcatcgagggccagaagaccgccgcgttc
gagatcgtggacgcgctcggggacgcccccgacatccacgtcctcccggtgggcaacgcc
ggcaacatcacggcgtactggaagggttaccgcgagtacgcggcggacggcgtgtccacc
cgcaccccgcggatgtgggggttccaggcgtccggcgcggcgccgatcgtcaagggcgag
ccggtgcgcgacccgcagaccatcgccaccgccatccgcatcggcaacccggcctcctgg
gcgttcgcggaggccgcgcgggacgagtccggcggcctcatcgaagcggtgaccgaccgt
cagatccttgccgcctaccggctgttggccgcgcgcgagggcgtcttcgtggagcccgcg
tcggcggcctcggtggccggactgctcaaggcggccgaggagggccggctcgacccgggc
cagcgcgtggtgtgcacggtgaccggaaacggcctgaaggaccccgactgggcggtggcc
ggcgccccgcagccgatcaccgtcccggtcgacgccgacgccgccgccgaacgcctcggt
ctggtgtaa

DBGET integrated database retrieval system