KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_41640Help
Entry
SCATT_41640       CDS       T02095                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCATT_41640
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCATT_41640
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCATT_41640
Enzymes [BR:scy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCATT_41640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4469780..4470868
Genome map
AA seq 362 aa AA seqDB search
MNAVASPRMSGTHQWRGIIEEYRDRLPVTAETPVVTLLEGGTPLVPAQLLSERTGCDVHL
KVEGANPTGSFKDRGMTMAITRAKEEGAQAVICASTGNTSASAAGYAVRAGMVCAVLVPQ
GKIALGKMGQALVHGARILQVDGNFDDCLELARGLSDKYPVALVNSVNPVRIEGQKTAAF
EIVDALGDAPDIHVLPVGNAGNITAYWKGYREYAADGVSTRTPRMWGFQASGAAPIVKGE
PVRDPQTIATAIRIGNPASWAFAEAARDESGGLIEAVTDRQILAAYRLLAAREGVFVEPA
SAASVAGLLKAAEEGRLDPGQRVVCTVTGNGLKDPDWAVAGAPQPITVPVDADAAAERLG
LV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcgcttcacctcgaatgtccggcacccaccagtggcggggcatcatcgag
gagtaccgggaccggcttccggtgaccgccgagacccccgtggtcacgctgctggagggt
ggcaccccgctcgttcccgcccagctgctgtccgaacggaccggctgtgacgtccacttg
aaggtcgagggggccaaccccaccggttccttcaaggaccgcggcatgacgatggccatc
acccgggccaaggaggagggcgcccaggcggtcatctgcgcctccaccggcaacacctcg
gcctcggccgccgggtacgcggtacgggccgggatggtctgcgcggtgctggtgccgcag
ggcaagatcgcgctgggcaagatgggccaggcgctggtgcacggcgcccggatcctccag
gtcgacggcaacttcgacgactgcctggagctggcccgcgggctgagcgacaagtacccg
gtggcgctggtcaactcggtcaacccggtgcgcatcgagggccagaagaccgccgcgttc
gagatcgtggacgcgctcggggacgcccccgacatccacgtcctcccggtgggcaacgcc
ggcaacatcacggcgtactggaagggttaccgcgagtacgcggcggacggcgtgtccacc
cgcaccccgcggatgtgggggttccaggcgtccggcgcggcgccgatcgtcaagggcgag
ccggtgcgcgacccgcagaccatcgccaccgccatccgcatcggcaacccggcctcctgg
gcgttcgcggaggccgcgcgggacgagtccggcggcctcatcgaagcggtgaccgaccgt
cagatccttgccgcctaccggctgttggccgcgcgcgagggcgtcttcgtggagcccgcg
tcggcggcctcggtggccggactgctcaaggcggccgaggagggccggctcgacccgggc
cagcgcgtggtgtgcacggtgaccggaaacggcctgaaggaccccgactgggcggtggcc
ggcgccccgcagccgatcaccgtcccggtcgacgccgacgccgccgccgaacgcctcggt
ctggtgtaa

DBGET integrated database retrieval system