KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_42340Help
Entry
SCATT_42340       CDS       T02095                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00010  Glycolysis / Gluconeogenesis
scy00030  Pentose phosphate pathway
scy00051  Fructose and mannose metabolism
scy00052  Galactose metabolism
scy00680  Methane metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_42340
   00030 Pentose phosphate pathway
    SCATT_42340
   00051 Fructose and mannose metabolism
    SCATT_42340
   00052 Galactose metabolism
    SCATT_42340
  Energy metabolism
   00680 Methane metabolism
    SCATT_42340
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCATT_42340
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SCATT_42340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: AEW96605
UniProt: F8JQD6
Position
4545386..4546411
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTAGGDCPGLNAVIRSVTHRGITGHGDEIIGFEDGFKGLLEGRFRPLDLNSVSGI
LARGGTILGSARLERARLHEAADNVAALQADHGIDVLIPIGGEGTLTAARMLSDAGMPVV
GVPKTIDNDISATDRTFGFDTAVTVATEAIDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAGGAHAILLPERPFDPADICAMVDQRFQRGKKFAVVCVAEGAHPIEGTMPYGHGEIDP
YGHERFIGIGTRLADELAGRLGKEAKPVILGHVQRGGVPTAYDRVLATRFGWHAVEAAHK
GAFGSMTALRGNHVELVPLRDAITVLKRVPPDRMEEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagttctcaccgccgggggcgactgcccggggctcaacgccgtcatccgc
tcggtgacccaccgcggcatcaccggacacggtgacgagatcatcggcttcgaggacggc
ttcaaggggctgctggaggggcggttccggccgctggacctcaactcggtcagcggcatc
ctggcccgcggcggcaccatcctcggctcggcccggctggagcgcgcccggctccacgag
gccgccgacaacgtggccgcgctccaggccgaccacgggatcgacgtcctgatccccatc
ggcggcgagggcaccctcaccgccgcccggatgctctccgacgccgggatgccggtggtg
ggggtgcccaagaccatcgacaacgacatctcggccaccgaccgcaccttcggcttcgac
accgccgtcaccgtcgccaccgaggccatcgaccggctgaagaccaccgccgagtcccac
cagcgggtgatggtggtggaggtgatgggacggcacgccggctggatcgccctggagtcc
ggcatggccggcggcgcccacgccatcctgctgcccgagcgccccttcgaccccgccgac
atctgcgccatggtcgaccagcggttccagcgcggcaagaagttcgccgtggtctgcgtc
gccgagggcgcccaccccatcgaggggacgatgccctacggccacggcgagatcgacccg
tacggccacgaacgcttcatcgggatcggcacccggctcgccgacgaactcgccggccgg
ctggggaaggaggccaagccggtcatcctcggccacgtccagcgcggcggcgtccccacc
gcgtacgacagggtgctcgccacccgcttcggctggcacgcggtggaggccgcgcacaag
ggcgccttcggcagcatgacggcgctgcgcggcaaccacgtggagctggtgccgctcagg
gacgccatcacggtgctcaagcgggtgccgccggaccggatggaggaggccgagtcggtc
ttctga

DBGET integrated database retrieval system