KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_42390Help
Entry
SCATT_42390       CDS       T02095                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCATT_42390
Enzymes [BR:scy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCATT_42390
Exosome [BR:scy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCATT_42390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4550724..4553168)
Genome map
AA seq 814 aa AA seqDB search
MLPGTFSPPTAPGASEPSTRPAGAQPEAAARGYRPGSRPPASGTAPRRAPAPSADRTTVT
ATAAPSGPPVPPVPADPPAPGGPVSAVLDPAERARLLSGAHHDPHALLGAHPVDGGVLFR
ALRPYAEAVAVVTGGVRAELADDGEGFFSAVLPLSEVPDYRLVVTYADGDHEVEDAYRLL
PSLGELDLHLIGEGRHEELWKALGARPMTHQGVTGTRFAVWAPNARGVRLVGDFNYWDGT
GHPMRSLGATGVWELFVPGLGEGTLYKFEITGPDGVRRVKADPLARRTEAPPATASVVTG
THHVWGDERWLAERGRTPVHQAPFSVYEVHLPSWRPGLTYRQLAEQLPAYVKELGFTHVE
LMPVAEHPFGGSWGYQVTSYYAPTARLGTPDDFRFLVDALHQAGIGVLMDWVPAHFPKDD
WALARFDGTPLYEPADPRRAEHPDWGTYEFDFGRTEVRNFLVANAVYWLEEFHIDGLRVD
AVASMLYLDYSREDGQWLPNAFGGRENLDAVAFLQEMNATVYRRCPGVVTIAEESTAWDG
VTRATHHTGPGGFGGLGFGLKWNMGWMHDTLQYVSHEPVHRKYHHGEMTFAMVYAYSENY
VLPISHDEVVHGKGSLVAKMPGDWWQQRATVRAYLAFMWAHPGKQLLFMGQEFAQGGEWS
HDSGPDWWLLDPAYTAAHDHAGVRDLVRDLNHRYLATPALWQQDTLPAGFEWIDAHAADD
NVLAFVRYAADGRPLVCVSNFSPVVREGYRIGVPDAGAASWREALNTDAAGYGGSGVGNA
VPPAVEALPWQGRERSVRLTLPPLATVWLEPQTG
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgggcaccttctcacccccgaccgcgcccggcgcctccgagccgtccacccgg
ccggccggtgcgcagcccgaggccgccgcgcgggggtaccggcccgggagccgtccgccc
gcctccgggacggctccgcgccgcgccccggcgccgtccgcggaccggaccaccgtgacc
gccaccgccgcgccgtccgggccgcccgtaccgccggtgcccgcggaccctcccgcgccc
ggcggaccggtgtcggccgtgctcgaccccgccgagcgcgcccggctgctgtccggcgcc
caccacgacccgcacgcgctgctgggcgcccacccggtggacggcggtgtcctcttccgg
gcgctgcggccgtacgccgaggcggtggcggtggtcaccggcggggtgcgggcggagctg
gccgacgacggcgaggggttcttcagcgcggtgctgccgctgtccgaggtgcccgactac
cggctggtggtcacctacgccgacggtgaccacgaggtcgaggacgcctaccggctgctg
ccctcgctgggcgagctggacctccatctgatcggcgaggggcgccacgaggagctgtgg
aaggcgctgggcgcccggccgatgacccaccagggggtgaccggcacccggttcgcggtg
tgggcccccaacgcccgcggggtccggctggtcggcgacttcaactactgggacggcacc
ggccacccgatgcgttcgctgggcgccaccggggtgtgggagctgttcgtgccgggcctg
ggcgaggggacgctgtacaagttcgagatcaccggcccggacggggtgcgccgggtcaag
gccgatccgctggcccggcgcaccgaggcgccgccggccaccgcgtccgtggtcaccggg
acgcaccacgtgtggggcgacgagcggtggctggccgagcgcggccggacgccggtgcac
caggcgccgttctcggtctacgaggtccacctgccgtcctggcgacccggtctgacctac
cgtcagctggccgagcagttgccggcgtacgtcaaggagctggggttcacccatgtcgag
ctgatgccggtggccgagcacccgttcggcggctcgtggggctaccaggtcacctcctac
tacgcgcccaccgcccggctggggaccccggacgacttccggttcctggtggacgccctc
caccaggcgggcatcggggtgctgatggactgggtgccggcccacttccccaaggacgac
tgggcgctggcccgcttcgacggcaccccgctgtacgagccggccgatccgcgccgggcc
gagcatccggactggggcacctacgagttcgacttcggccgcaccgaggtgcgcaacttc
ctggtggccaacgcggtctactggctggaggagttccacatcgacggcctgcgggtggac
gcggtggcctccatgctctacctggactactcgcgcgaggacggccagtggctgcccaac
gccttcggcggccgggagaacctggacgcggtggccttcctccaggagatgaacgccacc
gtctaccggcgctgcccgggcgtggtcaccatcgccgaggagtccaccgcctgggacggg
gtcacccgggccacccaccacaccggccccggcggcttcggcggcctgggcttcgggctg
aagtggaacatggggtggatgcacgacacgctccagtacgtctcccacgagccggtgcac
cgcaagtaccaccacggcgagatgaccttcgccatggtgtacgcctactcggagaactac
gtgctgccgatctcgcacgacgaggtggtgcacggcaaggggtcgctggtcgccaagatg
cccggcgactggtggcagcagcgcgccaccgtacgcgcctacctggccttcatgtgggcc
catccgggcaagcaactgctgttcatggggcaggagttcgcccagggcggcgagtggtcg
cacgactcggggccggactggtggctgctggacccggcgtacaccgcggcgcacgaccac
gccggggtgcgcgacctggtgcgcgacctcaaccaccgctacctggccacccccgcgctg
tggcagcaggacacccttccggccggcttcgagtggatcgacgcgcacgccgccgacgac
aacgtcctcgccttcgtgcggtacgccgccgacgggcgtccgctggtgtgcgtgagcaac
ttctcgccggtggtgcgcgaggggtaccggatcggggtgccggacgcgggcgcggcgtcc
tggcgggaggcgctcaacaccgacgcggccggctacggcggcagcggggtcggcaacgcc
gttccgccggcggtggaggcgctgccgtggcagggccgggagcgcagcgtgcggctgacg
ctgccgccgctggcgacggtgtggctggagccgcagaccggctag

DBGET integrated database retrieval system