KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_42700Help
Entry
SCATT_42700       CDS       T02095                                 

Definition
amidotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCATT_42700
Enzymes [BR:scy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SCATT_42700
Peptidases [BR:scy01002]
 Cysteine Peptidases
  Family C44
   SCATT_42700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4587829..4589715
Genome map
AA seq 628 aa AA seqDB search
MCGITGWVDFTRDLTRERHTTRAMTDTMACRGPDDEGCWSARHVALGHRRLAVIDVAGGR
QPMRTPETGPDGEPVAVISYSGEVYNFRELREELVLHGHHFRTRSDTEVVLRAYLEWGSG
FVGRLGGMYAFALWDNRTEELLLVRDRLGVKPLFHHPLDDGVLFGSEPKAILANPLATPR
LDLDGLRDALALARVPGRTPLTGVYEVKPGHLVRVRRGRLTEERYWSLRTRPHHDDLDTT
IATVRDLLTDTVDRQLVSDVPLCALLSGGLDSSALTAMAQRSLTAGRAGDAAGEVIRTFS
VDFAGYTENFTPEPFRETPDAPYVAELVRHVGTDHHEILLDTAQLVDPAVRRRVLRAWDL
PYGIGDHDPSLLLLFEAVRRRSTVALSGESADEVFGGYLWFHHPDAVRADTFPWHAVNAT
PVAEQATAFLDPALVKELALAEYVADTYREAVAEVEHLPGDDATERRMRVASHLNITRFL
PMLLDRKDRMSMAVGLEVRVPFCDHRLVSYVYNAPWAMKTFDGREKSLLRAATEQWLPPS
IVRRRKAPYPSTQDTGYDLAVNRELARIAADPASPAAPLLDRAALRAFLDRPLTGPYSMM
QRSVHTETPVRLDAWLGEYGVRLDGLTG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggaatcaccggatgggtcgacttcacccgtgatctgacccgcgaacgccacacc
acgcgggccatgaccgacacgatggcctgccgcggcccggacgacgaggggtgctggagc
gcgcgccacgtggcgctgggccaccgccgcctcgccgtcatcgacgtcgccggcggccgg
cagccgatgcgcacccccgagaccggccccgacggcgagccggtcgccgtcatcagctac
agcggcgaggtctacaacttccgcgaactgcgcgaggaactcgtcctgcacggccaccac
ttccgcacccgcagcgacaccgaggtggtgctccgcgcctacctggagtggggcagcggc
ttcgtcggacggctgggcggcatgtacgcgttcgccctgtgggacaaccgcaccgaggaa
ctcctcctggtccgcgaccggctcggcgtcaagcccctcttccaccaccccctcgacgac
ggcgtgctcttcggctccgaacccaaggccatcctcgccaacccgctggccaccccccgc
ctcgacctcgacggcctgcgcgacgccctcgccctggcccgggtccccggccgcaccccg
ctcaccggggtgtacgaggtcaaacccggccacctggtacgggtgcggcgcggccggctc
accgaggagcgctactggtcgctgcggacccggccgcaccacgacgacctcgacaccacc
atcgccaccgtgcgcgacctgctcaccgacaccgtcgaccgccaactggtctccgacgta
ccgctgtgcgccctgctctccggcggcctcgactccagcgcgctgaccgccatggcccag
cgctcgctcaccgccggacgcgccggggacgcggccggcgaggtgatccgcaccttctcg
gtcgacttcgccggctacaccgagaacttcacccccgaaccgttccgcgagacccccgac
gccccctacgtcgccgaactcgtccggcacgtcggcaccgaccaccacgagatcctgctg
gacaccgcgcaactggtcgaccccgcggtacgccgccgggtgctgcgcgcctgggacctg
ccgtacggcatcggcgaccacgacccctcgctgctgctgctcttcgaggccgtgcggcgg
cgctccacggtggcgctgtccggcgagtccgccgacgaggtcttcggcggctacctgtgg
ttccaccaccccgacgcggtccgcgccgacaccttcccctggcacgccgtcaacgccacc
cccgtcgccgagcaggccaccgccttcctcgaccccgccctcgtcaaggagctcgcgctg
gccgagtacgtcgcggacacctaccgcgaggcggtggccgaggtcgagcacctgcccggc
gacgacgcgacggagcggcggatgcgggtggcgagccacctcaacatcacccgcttcctg
cccatgctgctggaccgcaaggaccgcatgagcatggccgtcggcctggaggtacgggtg
ccgttctgcgaccaccggctggtgagctacgtctacaacgcgccctgggcgatgaagacc
ttcgacggccgggagaagagcctgctgcgcgccgccaccgagcagtggctgccgccctcg
atcgtccggcggcgcaaggccccctacccctccacccaggacaccgggtacgacctggcg
gtcaaccgcgaactggcccgcatcgccgccgacccggcgtcccccgccgcgccgctgctc
gaccgcgccgcgctgcgcgccttcctcgaccggccgctgaccgggccgtactcgatgatg
cagcgctcggtccacaccgagaccccggtacggctcgacgcgtggctcggggagtacggc
gtgcggctggacgggctcaccggctga

DBGET integrated database retrieval system