KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_46590Help
Entry
SCATT_46590       CDS       T02095                                 

Definition
UDP-N-acetylglucosamine transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scy00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:scy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5028407..5029936)
Genome map
AA seq 509 aa AA seqDB search
MADDYLVRIGKLIRDARQHRGWTQSQLAEALGTSQSAVNRIERGNQNISLEMIARIGEAL
DSEIVSLGYAGPMHLRVVGGRQLSGAIDVKTSKNACVALLCASLLNSGRTTLRRVARIEE
VYRILEVLGSIGVRTRWINDGNDLEIVPPATLDLDAMDTEAARRTRSVIMFLGPLMHRTD
RFKIPYAGGCDLGTRTVHPHMAALRHFGLEVTATTGSYHAEVDRTVSPSRAIVLTERGDT
VTENALLAAARHDGVTVIRNASSNYMVQDLCFFLEQLGVRVEGIGTTTLTVHGVAEIDRD
VDYAPSEDPVEAMSLIAAAVVTSSELTIRRVPIEFLEIELAVLEEMGLDHERSGEYPADN
GRTRLIDLTVRPSKLRAPLDKIHPMPFPGLNIDNVPFFAAIAATAQGSTLIHDWVYDNRA
IYLTELTRLGASVKLLDPHRVLVEGPTRWRSAEMMCPPALRPAVVVLLAMLAAEGTSVLR
NVYVINRGYEELAERLNSIGAQIETFRDI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgactacctcgtacgcatcggcaagctcatccgtgacgcccgccagcaccgc
gggtggacgcagtcccagctggcggaggcgctggggaccagtcagagcgcggtcaaccgg
atcgagcgcggcaaccagaacatcagccttgagatgatcgcccgcatcggcgaagcgctg
gacagcgagatcgtctccctgggctacgccggacccatgcatctgcgggtggtggggggc
cgtcagctctccggcgccatcgacgtcaagaccagcaagaacgcctgcgtggcgctgctg
tgcgcgtcgctgctcaactccggtcgcaccaccttgcggcgggtcgcccgcatcgaggag
gtctaccggatcctggaggtcctcggcagcatcggggtgcgcacccggtggatcaacgac
ggcaacgacctggagatcgtcccgccggccaccctcgacctggacgccatggacaccgag
gcggcccgtcgcacgcgcagcgtgatcatgttcctcgggccgctgatgcaccgcaccgac
cgcttcaagatcccctacgcgggcggctgcgacctgggcacccgcaccgtgcacccgcac
atggcggcgctgcgccacttcggcctggaggtcacggccaccaccggctcgtaccacgcc
gaggtggaccgcaccgtctcccccagccgcgccatcgtgctgaccgaacgcggcgacacg
gtgaccgagaacgccctgctggccgccgcccgccacgacggcgtcaccgtcatccgcaac
gccagctccaactacatggtccaggacctctgcttcttcctggagcagctcggcgtgcgg
gtcgagggcatcggcaccaccacgctgaccgtgcacggcgtcgcggagatcgaccgggac
gtggactacgcgccgtcggaggacccggtcgaggcgatgagcctgatcgccgccgccgtg
gtgacctcctcggagctgacgatccgccgggtgccgatcgagttcctggagatcgagctg
gcggtgctggaggagatgggcctggaccacgagcgcagcggcgagtacccggcggacaac
ggccgtacccggctgatcgacctgacggtacgcccgtcgaagctgcgggcgccgctggac
aagatccacccgatgccgttccccgggctcaacatcgacaacgtcccgttcttcgcggcg
atcgcggccaccgcccagggctcgaccctcatccacgactgggtctacgacaaccgcgcg
atctacctgaccgaactgacccggctgggtgcctcggtcaagctgctcgacccgcaccgg
gtgctggtcgaggggccgacccgctggcgcagcgccgagatgatgtgcccgcccgcgctg
cgccccgcggtggtcgtcctgctggccatgctcgccgccgagggcacctcggtgctgcgc
aacgtctatgtgatcaaccgcggttacgaggagctggcggaacgcctcaactccatcggc
gcgcagatcgagacgttccgcgacatctga

DBGET integrated database retrieval system