KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_46810Help
Entry
SCATT_46810       CDS       T02095                                 

Definition
oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCATT_46810
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SCATT_46810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5058598..5060175
Genome map
AA seq 525 aa AA seqDB search
MDVMSAARSQRPEETATPEAADGPEAPGGAAGAATLGHVVVVGGGISGLAAAHRLVTAGA
RVTVLEAADRLGGKLHADEIAGVPVDLGAESMLARRPEAVALARRVGLGPDLQPPATAQA
ALWTRGRLRPMPRGHVMGVPGDLQPLSASGVLSPAGLARIPLDHVLPRTEVGEDVAIGEY
VAARLGREVVDRLVEPLLGGVYAGNSYRLSMRAAVPQLYAAARAERSLIEGVRAVQAKAA
SSTAQESSGRAVTGDDRAGAAAGPVFMGIAGGVGRLPLAVADACRAAGADIRTGTRVHTL
RRTADGWRLAADGPGGRYALQADAVVLAVPGPAAARLLAAESPGAAAELSTVECAGMALI
TMAFRRRDLLNAPAGSGFLVPPVDGRTIKAATFATRKWGWIDQAGPDTFVLRTSIGRHGE
EADLAWDDTDLVRLSREDLAQAAGVTAVPVAARVTRWTEGLPQYPVGHLERTARVREHVA
KLPGLAVCGAAYDGVGIPACVATADRAADEVLATLRTAVRNDAGE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcatgagcgcagcgaggtcgcaacgtcctgaggaaaccgccaccccggaagcg
gccgacggcccggaggcccccggcggcgcggccggtgccgccacgctcgggcacgtcgtg
gtcgtcggcggcggcatctccgggctcgccgccgcccaccggctggtgaccgccggtgcc
cgggtcaccgtgctggaggccgccgaccggctcggcggcaaactccacgccgacgagatc
gccggggtccccgtcgacctgggcgccgagtccatgctggcccggcgcccggaggcggtc
gcgctcgcccggcgggtcggcctcggccccgacctccagccgccggccaccgcccaggcc
gcgctgtggacccggggccggctgcgcccgatgccgcgcggccacgtcatgggcgtcccc
ggcgatctccagccgctctccgcctccggggtgctctccccggccggcctcgcccgcatc
cccctcgaccacgtactcccgcgcaccgaggtcggcgaggacgtcgccatcggcgagtac
gtggccgcccgcctcggccgcgaagtggtcgaccggctcgtcgaacccctcctcggcggc
gtctacgcgggcaactcctaccgcctctccatgcgggccgccgtgccccagctgtacgcc
gccgcccgcgccgaacgctcgctgatcgagggcgtacgggccgtccaggccaaggcggcc
tcctccaccgcgcaggagtcctccggccgcgccgtcaccggggacgaccgggcgggcgcc
gcggccggaccggtcttcatgggcatcgccggcggcgtgggacggctgccgctcgcggtc
gccgacgcctgccgcgccgcgggcgccgacatccgcaccggcacccgggtgcacaccctg
cggcggacggccgacggctggcggctggccgcagacggccccggcggacggtacgccctc
caggccgacgccgtggtgctcgccgtccccggccccgccgcggcccggctgctcgccgcc
gagtcgcccggggcggcggccgaactgagcaccgtggagtgcgccggcatggcgctgatc
accatggccttccgccgccgcgacctgctgaacgcccccgccggcagcggcttcctggtg
cccccggtcgacggccgcaccatcaaggcggccaccttcgccacccgcaagtggggctgg
atcgaccaggccggcccggacaccttcgtgctgcgcacctccatcggacgccacggcgag
gaggccgacctggcctgggacgacaccgacctggtgcggctgtcccgggaggacctggca
caggccgccggggtcaccgcggtgccggtcgccgcccgggtgacccggtggaccgagggc
ctgccgcagtatccggtcggccacctggagcgcaccgcgcgcgtccgcgaacacgtcgcc
aagctgcccggcctcgcggtctgcggcgccgcctacgacggcgtgggcatcccggcctgc
gtcgccaccgccgaccgcgccgccgacgaggtactggccaccctgcgcacggccgtccgg
aacgacgcgggagaatag

DBGET integrated database retrieval system