KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_47730Help
Entry
SCATT_47730       CDS       T02095                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCATT_47730
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SCATT_47730
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SCATT_47730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5152846..5153769
Genome map
AA seq 307 aa AA seqDB search
MTTVLGQNQYGKAENRVVRITRDGDTHHIKDLNVSVALSGDMDDVHYSGSNANVLPTDTT
KNTVFAFAKEYGIESAEQFGIHLARHFVTSQEPIKRARIRVEEYSWERIDTSEDNSRFIG
SDEVRHSFVRKGQETRTAQITFDGQRWEVLTGLKDLTVLNSTSSEFWGYVKDKYTTLKED
YDRILATDVTAWWRHNWTSDEERMPNWERSYAQARKHILQAFAETYSLSLQQTLYQMGSR
VINSRPEIDEIRFSLPNKHHFLVDLEPFDLKNDREVYFAADRPYGLIEATVLRDGAQARI
PFDMTNL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgttctcgggcagaatcagtacggcaaggcggagaaccgcgtcgtcaggatc
acgcgggacggcgacacccaccacatcaaggacctcaacgtctcggtcgccctctccggc
gacatggacgacgtccactactcgggcagcaacgccaacgtactgcccaccgacaccacc
aagaacaccgtcttcgccttcgcgaaggagtacgggatcgagtcggccgagcagttcggc
atccacctcgcccgccacttcgtcaccagccaggaacccatcaagcgggcccgcatccgc
gtcgaggagtactcctgggagcgcatcgacacctccgaggacaactcccgcttcatcggc
tccgacgaggtccggcactccttcgtccgcaagggccaggagacgcgcaccgcccagatc
accttcgacgggcagcggtgggaggtgctcaccggcctgaaggacctgaccgtgctcaac
tccaccagctcggagttctgggggtacgtcaaggacaagtacaccaccttgaaggaggac
tacgaccgcatcctcgccaccgacgtcaccgcctggtggcggcacaactggaccagcgac
gaggagcggatgccgaactgggaacgctcctacgcccaggcccgcaagcacatcctccag
gcgttcgccgagacctacagcctctcgctccagcagacgctgtaccagatgggctcccgg
gtcatcaacagccgcccggagatcgacgagatccgcttctcgctgcccaacaagcaccac
ttcctggtcgacctagaaccgttcgacctcaagaacgaccgcgaggtctacttcgccgcc
gaccgtccctacggcctgatcgaggccaccgtgctgcgggacggcgcgcaggcccggatc
ccgttcgacatgaccaacctctga

DBGET integrated database retrieval system