KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_47770Help
Entry
SCATT_47770       CDS       T02095                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_47770
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCATT_47770
   00630 Glyoxylate and dicarboxylate metabolism
    SCATT_47770
Enzymes [BR:scy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCATT_47770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5157132..5158751)
Genome map
AA seq 539 aa AA seqDB search
MSEAASSPPAVVADGAPPVPRSREVLTDEALAFLAGLHRRFAPRRAELLARRKERRAEIA
RTGTLDFRPETADVRSGDWRVAPAPAALEDRRVEITGPTDRKMTVNALNSGARVWLADFE
DASAPTWHNVVSGQINLIDAYERRIDFTTPEGKSYALKDDAELATVVMRPRGWHLDERHL
TVDGEPVPGALVDFGLYFFHNARRLLAKDKGPYFYLPKTESYLEARLWNDVFVFAQDQLG
IPQGTIRATVLIETITAAFEMEEILYELRDHAAGLNAGRWDYLFSIVKNFRDAGEKFVLP
DRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDPEVNAKALEKVRADKER
EAGDGFDGSWVAHPDLVPVARAAFDAVLGERPHQKDRLREEVDVTADQLLAVDSLEAKPT
FEGLRNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWIDAGVVLDNGEKV
TAELVREVAAAELAAIRAESGEQAFAAGSWQRAHDLLLQVSLDETYVDFLTLPAYELLD
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccgcttcctccccgccggccgtcgtcgccgacggtgcgccgcccgtcccc
cggtcgcgggaggtgctgaccgacgaggcgctggcgttcctcgccgggctgcaccgccgg
ttcgcgccgcgccgcgccgaactgctggcccgccgcaaggagcgccgggccgagatcgcc
cgcaccggcaccctggacttccgccccgagaccgccgacgtccgctccggcgactggcgg
gtggccccggcgccggccgcgctggaggaccggcgggtggagatcaccggccccaccgac
cgcaagatgaccgtcaacgccctcaactccggcgcccgggtctggctcgccgacttcgag
gacgcctccgcgcccacctggcacaacgtggtctccggccagatcaacctgatcgacgcc
tacgagcgccggatcgacttcaccacccccgagggcaagagctacgccctcaaggacgac
gccgagctggccaccgtggtgatgcggccccgcggctggcacctggacgaacgccatctg
accgtggacggcgagccggtgcccggcgccctggtcgacttcggcctgtacttcttccac
aacgcgcgccggctgctggccaaggacaagggcccctacttctacctgcccaagaccgag
tcgtacctggaagcccggctgtggaacgacgtcttcgtcttcgcccaggaccagctgggc
atcccgcagggcaccatccgggccaccgtgctgatcgagacgatcaccgcggcgttcgag
atggaggagatcctctacgaactgcgcgaccacgccgccggcctcaacgccgggcgctgg
gactacctgttctccatcgtgaagaacttccgggacgccggtgagaagttcgtcctgccg
gaccgcaacgcggtgaccatgaccgccccgttcatgcgcgcctacaccgagctgctggtg
cgcacctgccacaagcgcggcgcccacgccatcggcgggatggccgcgttcatcccgtcc
cggcgcgacccggaggtcaacgccaaggctttggagaaggtcagggccgacaaggagcgc
gaggccggggacgggttcgacggctcgtgggtggcccaccccgacctggtgccggtggcc
cgggccgccttcgacgcggtgctgggcgaacgcccgcaccagaaggaccggttgcgcgag
gaggtggacgtcaccgccgaccagctgctggcggtggactcgctggaggcgaagccgacc
ttcgaggggctgcgcaacgccgtccaggtgggcatccgctacatcgaggcgtggctgcgc
gggctgggcgcggtcgccatcttcaacctgatggaggacgccgccaccgcggagatctcc
cgctcgcagatctggcagtggatcgacgccggggtcgtcctggacaacggcgagaaggtc
accgccgagctggtgcgcgaggtggccgccgccgaactggccgccatccgggccgagtcg
ggcgagcaggcgttcgccgccggctcctggcagcgcgcgcacgacctgctgctccaggtg
tcgctggacgagacctacgtcgacttcctcaccctgcccgcctacgagctgctggactga

DBGET integrated database retrieval system