KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_47870Help
Entry
SCATT_47870       CDS       T02095                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SCATT_47870
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCATT_47870
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SCATT_47870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5167820..5168308
Genome map
AA seq 162 aa AA seqDB search
MSSIYDIPLRTLAGDPATLAEHRGKALLVVNVASKCGLTPQYEGLERLHKRYADRGFTVL
GFPCNQFGGQEPGSSEEIATFCSATYGVTFPLYEKADVNGAGRQPLYTELTRTADADGEA
GDIQWNFEKFLIAPDGTVAARFRPRTDPEAPEVVSAIESLLP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagcatctacgacatcccgctgcgcaccctcgccggcgaccccgccaccctggcc
gaacaccgcggcaaggcgctgctcgtcgtcaacgtcgcctccaagtgcggcctgaccccc
cagtacgaagggctggagcggctccacaagcgctacgccgaccgcggcttcaccgtactg
ggcttcccctgcaaccagttcggcggccaggagccgggcagctccgaggagatcgccacg
ttctgctcggccacctacggcgtcaccttcccgctgtacgagaaggccgacgtcaacggg
gccggccggcagccgctctacaccgagctgacccgcacggccgacgccgacggcgaggcc
ggggacatccagtggaacttcgagaagttcctcatcgccccggacggcacggtggccgcc
cggttccggccgcgcaccgacccggaggcccccgaggtcgtctcggcgatcgagtcgctg
ctgccgtag

DBGET integrated database retrieval system