KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_47870Help
Entry
SCATT_47870       CDS       T02095                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:scy00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:scy00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5167820..5168308
Genome map
AA seq 162 aa AA seqDB search
MSSIYDIPLRTLAGDPATLAEHRGKALLVVNVASKCGLTPQYEGLERLHKRYADRGFTVL
GFPCNQFGGQEPGSSEEIATFCSATYGVTFPLYEKADVNGAGRQPLYTELTRTADADGEA
GDIQWNFEKFLIAPDGTVAARFRPRTDPEAPEVVSAIESLLP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagcatctacgacatcccgctgcgcaccctcgccggcgaccccgccaccctggcc
gaacaccgcggcaaggcgctgctcgtcgtcaacgtcgcctccaagtgcggcctgaccccc
cagtacgaagggctggagcggctccacaagcgctacgccgaccgcggcttcaccgtactg
ggcttcccctgcaaccagttcggcggccaggagccgggcagctccgaggagatcgccacg
ttctgctcggccacctacggcgtcaccttcccgctgtacgagaaggccgacgtcaacggg
gccggccggcagccgctctacaccgagctgacccgcacggccgacgccgacggcgaggcc
ggggacatccagtggaacttcgagaagttcctcatcgccccggacggcacggtggccgcc
cggttccggccgcgcaccgacccggaggcccccgaggtcgtctcggcgatcgagtcgctg
ctgccgtag

DBGET integrated database retrieval system