KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_48330Help
Entry
SCATT_48330       CDS       T02095                                 

Definition
bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCATT_48330
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCATT_48330
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCATT_48330
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SCATT_48330
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SCATT_48330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5209438..5212644)
Genome map
AA seq 1068 aa AA seqDB search
MSPTPHSASGTTGAAAATPGAASPAPPVPVADISDTGFGTTPIQQAMALAREHGPVFRRR
FGTFESLLVGSVDAVTELCDDERFVKAVGPVLTNVRQIAGDGLFTAYNDEPNWAKAHDIL
LPAFALSSMHTYHPTMLRVAKRLIAAWDTALADGAPVDVADDMTRMTLDTIGLAGFGYDF
GSFRRGEPHPFVAAMVRGLLHSQALLSRKADDGVDHSAADEAFRADNAYLAQVVDEVIEA
RRASGETGTDDLLGLMLGAPHPSDGTPLDAANIRNQVITFLIAGHETTSGALSFALYYLA
KNPAVLRRAQAEVDALWGDDPDPEPDYTDVGRLTYVRQVLNEALRLWPTAAAFGRQAVTD
TVLDGRVPMRAGDTALVLTPVLHRDPVWGDNVEAFDPERFSPEREAARPVHAFKPFGTGE
RACIGRQFALHEAVMLLGMLIHRYRFLDHADYRLRVRETLTLKPDGFTLKLARRTSADRV
RTVASRAAEGTAGQDAGLPTTARPGTTLTVLHGSNLGACREFAAGLADLGERCGFETTVA
PLDAYRAGDLPRTSPVVVVAASYNGRPTDDAAGFVSWLEQAGPGAADGVRYAVLGVGDRN
WAATYQKVPTLIDERLAECGATRLLERAAADAAGDLAGTVRGFGEALRRALLAEYGDPDS
VGAVAGAEDGYEVTEVTGGPLDALAARHEVVAMTVTETGDLADLTHPLGRSKRFVRLALP
DGATYRTGDHLAVLPANDPALVERAARLLGADPDTVLGVRARRPGRGTLPVDRPVTVREL
LTYHLELSDPATAAQIAVLADRNPCPPEQAELKKLAPGRASVLDLVERYPALTGRLDWPT
VLGTLLPQIRIRHYSVSSSPAVSPGHVDLMVSLLEADGRRGTGSGHLHRVRPGDVVYARV
APCREAFRIAAGDEVPVVMVAAGTGLAPFRGAVADRVALRSAGRELAPALLYFGCDHPEV
DFLHAAELRGAEAAGAVSLRPAFSAAPDGDVRFVQHRIAAEADEVWSLLKGGARVYVCGD
GSRMAPGVREAFTALYASRTGATAEQAAGWLADLVARGRYVEDVYAAG
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctacgccgcacagcgcgtccggcaccaccggcgcggcagccgccaccccgggc
gccgcgtccccggcgccccccgtccccgtggccgacatcagcgacaccggcttcggcacc
accccgatccagcaggcgatggcgctcgcccgcgagcacggaccggtcttccggcgccgg
ttcggcaccttcgagtcgctgctggtgggctcggtggacgcggtgaccgagctgtgcgac
gacgagcggttcgtcaaggcggtcggcccggtgctgaccaacgtccgccagatagccggc
gacggcctgttcaccgcctacaacgacgagcccaactgggccaaggcgcacgacatcctg
ctgccggccttcgcgctcagttcgatgcacacctaccaccccacgatgctaagggtcgcc
aagcggctgatcgccgcctgggacaccgcgctggccgacggcgccccggtcgacgtggcc
gacgacatgaccaggatgaccctggacaccatcgggctggccggcttcgggtacgacttc
ggctcgttccggcgcggcgagccgcacccgttcgtcgccgccatggtgcgcgggctgctg
cacagccaggcgctgctgagccgcaaggccgacgacggggtcgaccacagcgcggccgac
gaggcgttccgggccgacaacgcctatctggcccaggtggtcgacgaggtgatcgaggcc
cggcgggcgagcggtgagaccggcaccgacgacctgctcgggctgatgctgggcgccccg
cacccgtccgacggcaccccgctggacgcggccaacatccgcaaccaggtgatcaccttc
ctgatcgccggccacgagaccacctccggggcgctgtcgttcgccctgtactacctggcc
aagaacccggccgtgctgcgacgcgcccaggcggaggtggacgcgctgtggggcgacgac
ccggatccggagccggactacaccgacgtgggccggctgacctacgtgcggcaggtgctc
aacgaggcgctgcggctgtggccgacggcggctgccttcgggcgccaggcggtcaccgac
accgtgctggacggccgggtgccgatgcgcgccggggacaccgcgctggtgctcaccccg
gtgctccaccgcgacccggtgtggggcgacaacgtggaggcgttcgaccccgagcgcttc
agcccggagcgggaggcggcccgtccggtgcacgccttcaagccgttcggcaccggtgaa
cgcgcctgcatcgggcggcagttcgcgctgcacgaggcggtgatgctgctgggcatgctg
atccaccgctaccgcttcctggaccacgccgactaccggttgcgggtgcgcgagacgctc
accctcaagccggacgggttcaccttgaagctggcccggcgcacctcggcggaccgggtg
cgtacggtggcctcgcgggccgccgagggcaccgccgggcaggacgccgggctgcccacc
acggcccggccgggcaccacgctgaccgtgctgcacggctccaacctgggcgcctgccgg
gagttcgccgccgggctggccgacctgggcgagcggtgcggcttcgagaccacggtggcg
ccgctggacgcctaccgcgccggtgacctgccgcgcacctcgccggtggtcgtggtggcc
gcctcctacaacgggcgacccaccgacgacgcggccggtttcgtctcctggctggagcag
gccgggccgggcgccgcggacggggtgcggtacgcggtgctgggcgtcggcgaccgcaac
tgggcggccacctaccagaaggtgcccaccctcatcgacgagcggctcgccgagtgcggc
gcgacccggctgctggagcgggccgccgccgacgccgccggtgacctggccggcacggta
cgcggcttcggcgaggcgctgcggcgcgcgctgctggccgagtacggcgacccggacagt
gtcggcgcggtggccggcgccgaggacggttacgaggtcaccgaggtgaccggcggcccg
ctggacgcgctcgccgcccgccacgaggtggtggcgatgacggtgaccgagaccggcgac
ctggccgacctcacgcacccgctgggccgctccaagcggttcgtccggctggcgctgccg
gacggtgccacctaccgcaccggtgaccacctggccgtactgccggccaacgacccggcg
ctggtcgaacgcgccgcgcggctgctcggcgccgacccggacaccgtgctcggcgtgcgg
gcccggcgccccggacgcgggacgctgccggtggaccgtccggtgacggtacgcgaactg
ctcacgtaccacctggagttgtcggacccggcgaccgcggcgcagatcgcggtgctggcc
gaccgcaacccgtgcccgccggagcaggcggagctgaagaagctggccccggggcgggcg
agcgtgctggacctggtggagcggtacccggcgctgaccgggcggctggactggccgacc
gtgctgggcacgctgctgccgcagatccggatccgccactactccgtctcctcctccccc
gccgtctcccccggccacgtcgacctgatggtctcgctgctggaggcggacgggcggcgc
ggcaccggctcgggccatctgcaccgggtgcgcccgggtgacgtggtgtacgcgcgggtg
gcgccgtgccgggaggcgttccggatcgccgccggtgacgaggtgccggtggtgatggtg
gcggccggtaccgggctggcgccgttccggggcgcggtcgccgaccgggtggcgctgcgg
tcggcgggccgggaactcgccccggcgctgctgtacttcggctgcgaccaccccgaggtg
gacttcctgcacgcggccgagttgcgcggcgccgaggccgccggggcggtgtcgctgcgt
ccggcgttctccgcggcccccgacggtgacgtgcgcttcgtgcagcaccgcatcgccgcc
gaggccgacgaggtgtggtcgctgctgaagggcggcgcccgggtctacgtgtgcggggac
ggctcgcggatggcgcccggggtgcgcgaggcgttcaccgcgctgtacgcgtcccgtacc
ggcgccaccgccgagcaggccgccgggtggctggccgacctggtggcgcgggggcgttac
gtggaggacgtgtacgccgccgggtga

DBGET integrated database retrieval system