KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_50370Help
Entry
SCATT_50370       CDS       T02095                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCATT_50370
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SCATT_50370
Enzymes [BR:scy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCATT_50370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5438987..5439967)
Genome map
AA seq 326 aa AA seqDB search
MVSAPTTGGGQAPLRAHAVGSVMLMGHSTAGVARVREVTRALDALAVTAGGVRVPPLVAT
DQEGGTVQVLGGPGFTTIPSAVRQGRLAPERLQELAAGWGRQLRSAGVTVDLAPVADTVP
PGLGAANAPIGRLSREYGDDPAAVAAHSTAFLRGLDQAGVLATAKHFPGLGRVTGNTDFT
ADVTDATTTRDDAFLAPFRRAVRAGVPLVMISSARYPRIDAAHLAAFSPVVIGDMLRGDL
GFDGVVVSDDLGHAAAVRAVPPGDRAVDFLGAGGDLVLTADPASLPAMTAAVLARLPSDA
GLRAAVGRGARHVLVAKERAGLLRCG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggtctcggcgcccaccacgggcggcggccaggccccgctgcgggcgcacgcggtgggg
tcggtgatgctgatgggccacagcaccgccggggtggcccgggtgcgggaggtcacccgc
gcgctcgacgcgctcgccgtgacggccggcggggtccgggtgccgccgctggtcgccacc
gatcaggagggcggcaccgtgcaggtgctcggcgggccggggttcaccacgatcccgtcc
gccgtgcggcagggtcggctggccccggaacgcctccaggagctggccgccgggtggggc
cgtcagctgcgctccgccggggtcacggtggacctggccccggtggccgacaccgtgccg
cccgggctgggcgcggccaacgccccgatcggccggctctcccgcgagtacggcgacgac
ccggccgccgtcgccgcccacagcacggcgttcctgcgcgggctggaccaggccggggtg
ctcgccaccgccaagcacttccccgggctcgggcgggtcaccggcaacaccgacttcacg
gcggacgtgaccgatgcgacgaccacgcgcgacgacgcgttcctggccccgttccggcgg
gccgtgcgggccggcgtcccgctggtgatgatctcctcggcccgctacccgcgcatcgac
gcggcgcacctcgcggccttctcccccgtcgtcatcggcgacatgctccgcggcgacctg
gggttcgacggcgtcgtcgtctcggacgacctggggcacgccgccgcggtacgggcggtg
ccgcccggggaccgcgccgtggacttcctcggcgccggcggcgacctggtgctcaccgcc
gaccccgcctcgctgcccgccatgacggccgccgtcctggcccggctcccctccgacgcc
gggctgcgcgccgccgtcggacgcggcgcccggcacgtcctggtcgccaaggagcgggcc
gggctgctgcgctgcggctga

DBGET integrated database retrieval system