KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_50990Help
Entry
SCATT_50990       CDS       T02095                                 

Definition
fatty acid oxidation complex alpha-subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_50990
   01212 Fatty acid metabolism
    SCATT_50990
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCATT_50990
   00650 Butanoate metabolism
    SCATT_50990
  Lipid metabolism
   00071 Fatty acid degradation
    SCATT_50990
   01040 Biosynthesis of unsaturated fatty acids
    SCATT_50990
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCATT_50990
   00310 Lysine degradation
    SCATT_50990
   00380 Tryptophan metabolism
    SCATT_50990
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCATT_50990
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCATT_50990
   00281 Geraniol degradation
    SCATT_50990
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SCATT_50990
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SCATT_50990
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCATT_50990
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SCATT_50990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5509101..5511275
Genome map
AA seq 724 aa AA seqDB search
MPESTTIRWEQDADGVVTLVLDDPGQSANTMNAAFADSLDAVVGRLESERDTIRGVVVTS
AKKTFFAGGDLRDLIRATPENAAEVFEGGMRVKRLLRRLETLGRPVVAAINGAALGGGYE
IALACHHRVALDAPGSRIGLPEVTLGLLPGSGGVVRTVRLMGIADALLKVLLQGTRYTPR
RAVEAGLVHELAATPEELTAKARAFIDAHPDARQPWDTDGYKIPGGTPAHPAFAANLPAF
PANLSKQLGGAPYPAPRDILAAAVEGSQVDFDTAQVIEARYFTELACGPISKNMIQAFFF
DMQAVNSGASRPAGVEPSTVTRVAVLGAGMMGAGIAYACAKSGLDVVLKDVTAEAAERGK
AYSATLLDKALAKGRTTERERDELLARITPTADTADLAGCDAVIEAVFEDTALKHKVFQE
IEGVVAPDALLCTNTSTLPITLLAEGVQRQEDFIGLHFFSPVDKMPLVEIVKGERTGQTA
LARAFDLVRRIRKTPIVVNDSRGFFTSRVIGQFINEGVAMVGEGVEPASIEQAAAQAGYP
AKVLTLMDELTLTLPRKIRNETRQAVEAAGGTWTAHPAEAVIDRMVDEFGRTGRGGGAGF
YDYADGRRTRLWPGLREHFTRPDADVPFTDIKERMLFAEALDSVRCLEEGVLTSVADANI
GSILGIGFPAWTGGVLQYVNGYEGGLPGFVARARELQAAYGDRFAPPPLLLAKAERGEVF
TDAR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagagcaccacgatccgctgggaacaggacgccgacggtgtcgtcaccctcgtc
ctcgacgaccccggccagtccgccaacaccatgaacgcggccttcgccgactccctcgac
gccgtcgtcggccgcctggagagcgaacgcgacaccatccggggcgtcgtcgtcacctcc
gccaagaagaccttcttcgccggcggcgacctgcgcgacctgatccgcgccacccccgag
aacgccgccgaggtcttcgagggcggcatgcgcgtcaagcggctgctgcgccgcctggag
acgctcggccggccggtcgtcgccgccatcaacggcgcggccctcggcggcggttacgag
atcgccctcgcctgccaccaccgcgtcgccctcgacgcccccggcagccgcatcggcctg
cccgaggtcaccctcggcctgctgcccggcagcggcggcgtggtccgcacggtacggctg
atggggatcgccgacgcgctgctcaaggtgctcctccagggcacccggtacaccccgcgc
cgcgcggtggaggccggcctggtccacgaactcgccgccacgcccgaggagttgacggcc
aaggcccgcgccttcatcgacgcccaccccgacgcccgccagccctgggacaccgacggc
tacaagatccccggcggcaccccggcccaccccgcgttcgccgccaacctccccgccttc
ccggccaacctcagcaagcaactgggcggcgccccctaccccgcgccccgcgacatcctg
gccgccgccgtcgagggctcccaggtcgacttcgacaccgcccaggtcatcgaggcccgc
tacttcaccgaactggcctgcggaccgatctcgaagaacatgatccaggcgttcttcttc
gacatgcaggcggtcaactccggcgcctcccgcccggccggcgtcgagccgtccaccgtc
accagggtcgccgtcctcggcgccggcatgatgggcgccggcatcgcctacgcctgcgcc
aagtccggcctggacgtggtcctcaaggacgtcaccgccgaggccgccgaacgcggcaag
gcgtactcggccaccctgctcgacaaggcgctcgccaaggggcgcaccaccgagagggaa
cgcgacgaactgctggcccggatcacccccaccgccgacaccgccgacctggccggctgc
gacgcggtgatcgaggcggtcttcgaggacaccgccctcaagcacaaggtcttccaggag
atcgagggcgtcgtcgcccccgacgcgctgctgtgcaccaacacctccaccctgccgatc
accctgctcgccgagggcgtccaacgccaggaggacttcatcggcctgcacttcttctca
cccgtggacaagatgccgctggtggagatcgtcaagggcgagcgcaccggacagaccgcg
ctggcccgcgccttcgacctggtccgccggatccgcaagaccccgatcgtggtcaacgac
tcccggggcttcttcacctcccgcgtcatcggccagttcatcaacgagggcgtcgccatg
gtcggcgagggcgtcgaacccgcctcgatcgagcaggccgccgcccaggccggctacccg
gccaaggtgctgacgctgatggacgagctgaccctgaccctgccgcgcaagatccgcaac
gagacccggcaggccgtcgaggcggccggcggcacctggaccgcccaccccgccgaggcc
gtcatcgaccgcatggtcgacgagttcggccgcaccggacgcggcggcggcgccggcttc
tacgactacgccgacggccggcgcaccaggctctggccggggctgcgcgaacacttcacc
cgccccgacgccgacgtccccttcaccgacatcaaggagcggatgctcttcgccgaggcg
ctggactcggtgcgctgcctggaggagggcgtgctgacctcggtcgccgacgccaacatc
ggctccatcctcggcatcggcttccccgcctggaccggcggggtgctccagtacgtcaac
ggctacgagggcggcctgcccggcttcgtagcccgggccagggaactccaggcggcctac
ggcgaccgcttcgccccgccgccgctgctgctggccaaggcggaacgcggcgaggtcttc
accgacgcccgctga

DBGET integrated database retrieval system