KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_51450Help
Entry
SCATT_51450       CDS       T02095                                 

Definition
glycerol kinase 1
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SCATT_51450
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SCATT_51450
Exosome [BR:scy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCATT_51450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5559281..5560801)
Genome map
AA seq 506 aa AA seqDB search
MTDTHAGPFIAAIDQGTTSSRCIVFDRDGRIVSVDQKEHEQIFPKPGWVEHDAAEIWTNV
QEVVAGALAKAGIGKDDVKALGITNQRETTVLWDKATGEPVHNAIVWQDTRTDALCKELG
RNVGQDRFRRETGLPLASYFAGPKIRWMLDNVEGLRERAERGEILFGTMDSWVIWNLTGG
TEGGVHVTDVTNASRTLLMNLQTLSWDERILSSMEIPAAVLPEIRSSAEVYGTAKGALEG
VPVASALGDQQAALFGQTCFAKGEAKSTYGTGTFLLLNTGETPVNSYNGLLTTVGYRIGD
QAPVYALEGSIAVTGSLVQWMRDQMGLISTAAEIETLASSVEDNGGAYFVPAFSGLFAPY
WRSDARGVIAGLTRYVTKAHIARAVLEATAWQTREIVDAMAKDSGVELTALKVDGGMTSN
NLLMQTIADALDAPVVRPMVAETTCLGAAYAAGLAVGFWQDTDELRANWRRAAEWTPRMD
AATRDREYKNWLKAVERTMGWIEEEH
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacccacgccgggccgttcatcgccgccatcgaccagggcaccacctcctcc
cgctgcatcgtcttcgaccgcgacggccgcatcgtctccgtcgaccagaaggagcacgag
cagatcttccccaagccgggctgggtcgagcacgacgccgccgagatctggaccaacgtc
caggaagtggtggccggcgcgctggccaaggcgggcatcggcaaggacgacgtcaaggcg
ctgggcatcaccaaccagcgcgagaccaccgtgctgtgggacaaggcgaccggtgagccg
gtgcacaacgccatcgtctggcaggacacccgcaccgacgccctctgcaaggagctgggc
cgcaacgtcggccaggaccgcttccgccgcgagaccggtctcccgctggccagctacttc
gccggccccaagatccgctggatgctcgacaacgtcgaggggctgcgggagcgcgccgaa
cgcggcgagatcctcttcggcaccatggacagctgggtgatctggaacctcaccggcggc
accgagggcggcgtgcacgtcaccgacgtcaccaacgcctcgcgcaccctgctgatgaac
ctgcagaccctcagctgggacgagcggatcctgtcctccatggagatcccggccgccgtg
ctcccggagatccgttcctccgccgaggtctacggcaccgccaagggcgccctggagggc
gtgccggtggcctccgccctcggcgaccagcaggccgccctgttcggccagacgtgtttc
gccaagggcgaggcgaagtccacctacggcaccggcaccttcctgctgctgaacaccggt
gagaccccggtgaactcctacaacggcctgctgaccaccgtcggctaccggatcggcgac
caggccccggtctacgccctggagggctcgatcgcggtgaccggctcgctggtgcagtgg
atgcgcgaccagatgggcctgatcagcacggccgccgagatcgagacgctggccagctcg
gtggaggacaacggcggcgcctacttcgtgcccgccttctccggactgttcgccccctac
tggcgttccgacgcgcgcggtgtcatcgcggggctcacccgctacgtcaccaaggcgcac
atcgcccgcgcggtgctggaggccaccgcctggcagacccgggagatcgtcgacgccatg
gcgaaggactccggcgtggagctgaccgccttgaaggtggacggcggcatgacctccaac
aacctgctgatgcagaccatcgccgacgcgctcgacgcccccgtggtgcgtccgatggtc
gccgagaccacctgcctgggcgccgcctacgcggcgggcctggcggtcggcttctggcag
gacaccgatgagctgcgggccaactggcggcgcgcggccgaatggaccccccgtatggac
gcggccacccgtgaccgcgagtacaagaactggctcaaggccgtcgagcggaccatgggc
tggatcgaagaggagcactga

DBGET integrated database retrieval system