KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_53430Help
Entry
SCATT_53430       CDS       T02095                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00230  Purine metabolism
scy01100  Metabolic pathways
Module
scy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCATT_53430
Enzymes [BR:scy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SCATT_53430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase AAA_33 AAA_29 AAA_22 MMR_HSR1 AAA_30 AAA_25 CbiA AAA_28 Rad17 ABC_tran AAA_5 DUF3618 CPT AAA_23 RNA_helicase Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AEW97714
UniProt: G8X3V9
Position
5760307..5760912
Genome map
AA seq 201 aa AA seqDB search
MSTASPRGTAPVPPAGQPRLTVLSGPSGVGKSTVVAHLRRVHPEVWLSVSVTTRKPRPGE
VDGVQYHFVDGDEFDKLVANGELLEWAEFAGNRYGTPRQAVLERLEAGVPVLLEIDLQGA
RLVRRSMPQARLVFLAPPSWDELVRRLTGRGTESPEVIERRLEAARVELAAESEFDVTLV
NTSVEDVTRELLALMTHNSGG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgcgtctccccgggggacggcccccgtccccccggccggacaaccgcggctg
accgtgctctccggcccctccggggtcggcaagagcacggtcgtcgcgcatctgcgtcgt
gtacaccccgaagtctggctgtccgtctccgtcaccacccgcaagccccgcccgggtgag
gtcgacggggtgcagtaccacttcgtcgacggtgacgagttcgacaagctggtcgccaac
ggcgagttgctggagtgggccgagttcgccggcaaccgctacggcaccccgcgccaggcc
gtcctggagcggctggaggcgggcgttccggtgctgctggagatcgacctgcaaggcgcc
cggctggtgcgccgctccatgccgcaggcccggctggtcttcctggccccgccgagctgg
gacgagctggtgcgccggctcaccggccgcggcaccgagtcgcccgaggtgatcgagcgg
cggctggaggcggcccgggtcgagctggcggccgagtcggagttcgacgtcaccctggtc
aacacctccgtcgaggacgtcacgcgcgaactgctagccttgatgacgcataactctggg
ggctga

DBGET integrated database retrieval system