KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_55310Help
Entry
SCATT_55310       CDS       T02095                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCATT_55310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCATT_55310
  Lipid metabolism
   00071 Fatty acid degradation
    SCATT_55310
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCATT_55310
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCATT_55310
   00626 Naphthalene degradation
    SCATT_55310
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCATT_55310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5942314..5943135)
Genome map
AA seq 273 aa AA seqDB search
MPGHEIVGRVVEAGHAVRGFAPGDRVGAAWLAGTCGRCAYCRSGRENLCPRSRYTGWDVD
GGYAGHVLVDARYAYRPPAGWADDETAPLLCAGIIGYRALCRAELPPGGRLGVYGFGASA
HLTAQLALARGATVHVLTRGERARRLALDLGAASARDAYETPPEPLDAAILFAPAGELVP
VALAALDRGGTLAIAGIHLSAVPALDYRRHLFQERTVRSVTANTREDGRAFLAEAARLRP
SVRLTRYPMRRADRALADLAAGEVTGVAVLMAQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggccacgagatcgtcgggcgggtggtcgaggccggccacgcggtgcgcggcttc
gcccccggcgaccgggtcggggccgcctggctggccggcacctgcggccgttgcgcctac
tgccggtcggggcgggagaacctgtgcccgcgttcccggtacaccggctgggacgtcgac
ggcgggtacgccggccacgtgctggtggacgcccgctacgcctaccggcccccggccggc
tgggcggacgacgagacggcgccgctgctgtgcgccggcatcatcggctaccgcgccctg
tgccgcgccgaactgccgcccggcggacgtctgggcgtctacgggttcggcgcctccgcc
catctgaccgcgcagctcgcgctggcccgcggcgccaccgtgcacgtgctcacccgtggc
gagcgggcccgccggctcgcgctcgacctgggcgcggcgtccgcccgggacgcgtacgag
acaccgccggagccgctggacgcggcgatcttgttcgcgcccgccggtgagctggtgccg
gtggcgctggccgcgctcgaccggggcggcaccctcgccatcgcgggcatccacctgtcc
gccgttcccgcgctggactaccggcgccatctgttccaggaacgtacggtgcgcagcgtc
accgccaacacccgtgaggacggccgggcgttcctcgccgaggccgcccggctgcgcccc
tccgtgcggctgacccgctatccgatgcgccgggccgaccgggcgctggccgacctggcg
gcgggcgaggtgacgggggtggcggtgctgatggcgcaatga

DBGET integrated database retrieval system