KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_56350Help
Entry
SCATT_56350       CDS       T02095                                 

Definition
secreted alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scy00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:scy00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6053575..6055185)
Genome map
AA seq 536 aa AA seqDB search
MHVCARPRSLRTGVVLTLLAALLPALAVLGGAGSAHALDDGLARTPPMGWNDWNAFGCSV
TERLVEQTADTMVASGMKDAGYTYVNIDDCWMTHSRDAAGHLVPDPAKFPDGIKGTADYV
HRKGLKLGIYESAGTATCAGYPGSLGHERQDAADFAAWGVDYLKYDNCNNQGVPYQQRYD
AMRDALKATGRPIVYSLCEWGEDSVWTWGAATGHLWRTTGDISASFGSMLSIYRSNVRLA
GYAGPGGWNDPDMLEVGNGMSFTEDRTEFTLWAEMAAPLIAGTDLRTATPATLSLYTNRD
VIAVDQDPLGRQGTEVSSSGGLHVLAKPLAGGDVAVVLFNENAAPATITTSASTAGLPAA
PSYRLTNLWSHQVTSTGGTVSAQVPGHGTVMYRVSVGGGSSVGTTHPLAGASSARCLDVA
GGATTPGTPVDIRDCDGGAWQAWTPTASGELRVYGGTQCLDAYDNRTSPGTPVKLWPCNG
GANQRWNLDPDGTVTGVQSGLCLDVTGGNTPAGNVNGTRVELWDCNGGANQQWRLV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgtatgcgcccgcccgcgaagcctgcgtaccggcgtcgtactgaccctgctcgcg
gccctgctccccgcgctcgccgtcctcggcggcgcggggagcgcccacgccctggacgac
ggactggccaggaccccgccgatggggtggaacgactggaacgccttcggctgttcggtc
accgagcgactcgtcgagcagaccgccgacacgatggtggcctccggcatgaaggacgcc
ggctacacctacgtcaacatcgacgactgctggatgacccactcccgggacgccgccggc
cacctggtgcccgacccggcgaaattccccgacggcatcaagggcaccgccgactacgtc
caccgcaaggggctcaaactcggcatctacgaaagcgccggcaccgcgacctgcgccggc
taccccggcagcctcggccatgagcgccaggacgcggccgacttcgccgcctggggtgtc
gactacctcaagtacgacaactgcaacaaccagggcgtgccctaccagcagcggtacgac
gccatgcgggacgccctgaaggccaccggccggccgatcgtctacagcctgtgcgagtgg
ggcgaggactcggtctggacctggggcgcggccaccggccatctgtggcggaccaccggg
gacatctcggcctccttcggctccatgctgtcgatctaccgcagcaacgtgcggctcgcc
ggttacgcgggccccggcggctggaacgaccccgacatgctggaggtcggcaacggcatg
tcgttcaccgaggaccgcaccgagttcaccctgtgggccgagatggccgccccgctgatc
gccggcaccgatctgcgcaccgcgaccccggccaccttgtcgctgtacaccaaccgcgac
gtgatcgcggtggaccaggacccgctgggccggcagggcaccgaggtctcctcctccggc
ggcctccacgtcctcgccaagccgctggcgggcggtgatgtcgcggtggtgctcttcaac
gagaacgccgcgccggccaccatcaccaccagcgcctcgaccgcgggcctgccggccgcg
ccctcctaccggctcaccaacctgtggagccaccaggtcaccagcaccggcgggacggtc
tccgcccaggtccccgggcacggcacggtgatgtaccgggtctccgtaggcggcggcagc
agcgtcggcaccacgcatccgctggccggggcctcctcggcgcgctgcctcgacgtggcc
ggcggcgccaccacacccggcaccccggtcgacatccgggactgcgacggcggcgcctgg
caggcgtggaccccgacggcctccggcgaactgcgcgtctacggcggcacccagtgcctg
gacgcctacgacaaccggacctcgccgggcaccccggtcaagctgtggccctgcaacggc
ggcgccaaccagcggtggaacctcgacccggacggcacggtcaccggggtccagtccggc
ctgtgcctcgacgtcaccggcggcaacaccccggccggcaacgtcaacggcacccgcgtg
gaactgtgggactgcaacggcggcgccaaccagcagtggcgactggtctga

DBGET integrated database retrieval system