KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_56710Help
Entry
SCATT_56710       CDS       T02095                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCATT_56710
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCATT_56710
Enzymes [BR:scy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SCATT_56710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6091453..6092241
Genome map
AA seq 262 aa AA seqDB search
MTVMESSTRNREGTPAPLAGRTALVTGAASGIGRACAVALAEAGAHVHVVDIAADGAEEV
AARVGGRAHVADLADPDAVDALPADVDIVVNNAGLQHVAPVHEFPPERFALIQRVMVEAP
FRILRRTLPGMYRRGWGRVVNISSVHGLRASPYKSAYVAAKHALEGLSKVVALEAAPHGV
TSNCVNPGYVRTPLVERQIAAQAEAHGIGEDEVVREVMLERTAIKRLIEPEEVAAVVLWL
CGPHSGYLTGASVPVDGGWTAH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcatggaaagcagcacacgaaaccgggagggcacccccgcgcccctcgccggc
cgcaccgccctggtgaccggtgcggccagcggcatcggcagggcctgcgccgtggcgctc
gccgaggccggcgcccacgtccacgtggtcgacatcgccgccgacggcgccgaggaggtc
gccgcacgcgtcggcggccgggcccacgtcgccgacctcgccgatccggacgcggtggac
gccctgcccgccgatgtcgacatcgtggtgaacaacgccgggttgcagcacgtggccccg
gtgcacgagttcccgccggagcggttcgccctcatccagcgggtgatggtggaggccccg
ttccgcatcctgcgccgcaccctgcccgggatgtaccggcgcggctgggggcgggtggtc
aacatctcctcggtgcacggactgcgcgccagcccgtacaagtcggcctacgtggcggcc
aagcacgcgctggaggggctgagcaaggtggtcgcgctggaagccgccccgcacggggtg
accagcaactgcgtcaaccccggctacgtccgcaccccgctggtcgagcggcagatcgcc
gcccaggccgaggcgcacggcatcggcgaggacgaggtggtgcgcgaggtgatgctggaa
cgcaccgcgatcaaacggctcatcgagcccgaggaggtcgccgcggtcgtgctgtggctg
tgcggcccccacagcggctacctgaccggcgcctcggtcccggtggacggcggctggacg
gcgcactga

DBGET integrated database retrieval system