KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_56840Help
Entry
SCATT_56840       CDS       T02095                                 

Definition
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
Orthology
K12743  
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Penicillin and cephalosporin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SCATT_56840
Enzymes [BR:scy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     SCATT_56840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6110715..6121835)
Genome map
AA seq 3706 aa AA seqDB search
MMSARYPRTAADWTARIEGVSGERCDLEMLLKDEWRNRIAVRDDDPGVRATRRRELAIGG
PVHQALRRASGDGVSVAAFALATLHSVMRAYGHGNRTVAALVDATGTDDMRRARVLPVIV
DHEAQGRLSRAAAVREIDAELRHRDAWTAPDALLQRGLFDMLLVLADREIPPAELPSAPL
AVIVRDAADEGCLRWTMAYAGELFEDRTIAGVLDVVREVFGQYVTGPAEPVAGIELASAE
QRERLREWNATDGDFPADVRLEDLFTRAARRSPDQQAVVFGDTTLTYRTVDERSDRLARW
LIGPEVGVAPQELIGLYLDKSDLGVVATLGIWKAGAAYVPIDPAYPAERVRFTVGDTGLT
AVVTNRHHAERLREILGDRHAGVRVIEIETVLARSAADPSPGDLPRPEVSSRHLAYVTYT
SGTTGVPKGVPKYHDSVVNSITDLSERYDMRRPGEERVALFASYVFEPHLRQTLIALINS
QTLVIVPEDVRLDPDRFPAYIERHRVTYLNATGSVLHHFDLRRCTSLKKLLLVGEELTAA
GLRRLRETFSGRIVNEYAFTEAAFVTAVKEFAPGVTERPDRSIGRPVRNVKWYVLSQNLK
QLPIGAIGELYIGGCGVAPGYLNRDELTAERFLANPYQSERDKARGMNARLYRTGDLARM
LPSGEVEFMGRGDFQLKLNGVRVEPGEIEARATEYPGVRRCVVVAREGTAGTGERHLVGY
YVTEPAAEVTEEELLAFLEQRLIRIMVPARMVRMDAIPVNVNGKADWRALPEVDLARPGG
AAADGGAAGGVLGRLREIWSAVLGVPAGRIGDGDDFFRLGGQSISCILLVARIRRQLGVF
VGVEDVFELRTLEKLAHHLERRERHTPAPDPGPDAVPEPADGEPVRLLAGGLQQGLLYHA
LKRRHGDDAYVMQSVHRYHCRIDPELMREAWQHARRKYPALRLRFEWDGEPLQVVDNDDK
PFDWRYVDLSGTADPGEQDARIRGLQERDRTEPYDPGAGRLFRVYLIKQRADLFSLILSC
HHIILDGWSLPVLHDDVHRMYLRLLRGEEIEPAVDGAYLAAQRHWAARRGDHVGYWTRQV
ERIDERGDFAGLVKEDIRYQVALGEYDHVREHRTRRLALGAETTAALKAVCAAHQVTLHS
VLQFVWHQVLHAIGGGNTTVVGTIVSGRDPHVDGIENSVGLFINTLPLIVDHDDQETGSV
ADALGGIQAAVNTMNARCTVELGRLETGGMKRRLFDTLLVLENYPRLLAEDEERAHRELL
RYEKAYDADKVDYPLAVVAREEDDELTVTLWYAGELFDDTTVETLLDVARTLFVQVAEDV
TRPVAELELVPAAMIGRFDAWNRTRAAFPADRTLHGIFEEMAAAWPDETAVVYRDTSLTY
RQLNERANRLAHHLLSVARLRPGDLVGLVLDKSELMITAILAVWKTGAAYVPVDPGYPDD
RISFMLQDTSARLVVTNHVHGDRLRALPDTDGLPVLDVERLPLDEHPAHDPVTAVTATDL
AYAIYTSGTTGRPKAVLVEHQGVVNLQVSLAKIFGLDKGAGDEALLSFSNYVFDHFVEQM
TDALLNGQKLVVLDDTMRTDAERLYKYINDHDVTYLSGTPSVLSLYDWSTTTSLTRIDAI
GEDFTEPVFNKIRGTFPGTIINGYGPTEISITSHKRPYAPGERRSTKSIGHPVANTTAYV
LDRHLRRVPVGGMGELYIGGVGVTRGYLNRDELTAERFIANPFQTPREKAAGYNARLYRT
GDLVRWLPGGELECLGRTDLQVKIRGQRVELGEVEAALSSYPGVTRALVVAREHHAAGFT
APQKYLVGFYVCDRDLDEHEVKQWMRGKLPEAVVPSRVLRITDIPVTPSGKLDTRRLPET
DFASGDGVAYVAPSDDVEARLCGIWSTVLGVPAERVGVRDDFFALGGDSLRAMVLAQAVT
TAFGRGLGVATVLQHTTLGAQARHIRQAAARADDEDLRPAAGTGRVPVSPAQERLLFIDE
FEGGTAAYNIPFALRIATGDTDRITRALHTLLRRHPALRTLLRTDEDGVRRQHVMPAEEA
SAGFDVPVRTVDGEAELDERLVEGSGHVFRPAEELPVRAELFRLAGARESTYLGLVFHHT
CFDGWSWNTFREELAALLRGVPETQLPPVRGTYAEFAVWQRQHLTGSRTAELTEFWTGAL
AGYETVRLPLDRPRPARFDYRGREIEFALDEPVTRALRALAGSARVSLYSVLLGAWCLTL
HVYTGQDDFVVGTPSANRGRPEFDRTVGFFANLLALRVRVETGATLAEYVRAVGAGVVAA
QVHGELPFEQLVKELDPRKDPSRHPVLQVNFTLRKDAGTTDEGSALSDYTPDAGGWTTTK
FDLSATLTETAEGLTGNLTYAASLFEDDSAHGFITTFRHVLREFARLSSGGGEQSRLTEV
GYVDVTPPSVTGATDGTPVPAAPRTLHEVFAETAAVWPDRTAVVCGDVELTYRQLDERAD
ALAHQLRSVVALRPGELVGLVLDKSELMVVAILAVWKAGAAYLPIDPGYPDDRISFMLQD
TGARLVVANHVHGERLRTLPATGGLPVLDVERLPLDGHPASAPVTEVTAADPAYAIYTSG
TTGRPKAVLVPHRAVDSFRRQLTGRYFGGPDTSREGVLFLANYVFDFSVEQLALSVLAGH
ALVVPPVSPADDDGFADYANRAGVTYLSGTPTQIQQLDLARLTGLRCVLVAGEAFHERHF
AKIRAEFSGPIVNAYGTTETAVYNTVRRFEPGEPYRNSLGAPLGNTRLYVLGAGMRPLPP
GAVGELYLAGECVTDGYLNRPELTRERFLPNPLRTEAERAAGRYPVVYRTGDLVRLTRDG
ELRYVGRNDAQVKIHGVRVEPGEVESVLAGCPGIGECAVVAAPDERSPDGRRLVAYYVAE
PGAAVDEDAVFTALRARLMAAMVPSLLVRLDGPLPMTVNGKLDAKALPAPSGSARRAAYA
PPRSRTEARLCRLWGDHLPGDTVGIDDDFFRSGGDSISALHLAGRMQRELGRRVGVKDIF
DFPTVRRLADNVLAAPEDGPGTGDAGEAAPEARPVGEAPLLPVQEWFFAKPLTDRAWWNQ
TFAVRVPPLDVARLREAVTRLIGHHDAFRLRYTTSGTQVTQSYQADDPRTVLHELDVSGL
GDEEIRRRLARWQSGFDLAHGPLHSVAYLHGFPDGGARVWFALHHLIVDTVSWHILAQDL
EILYHGGRLEEKTSSYRQWAEALRRYVAEEDERRMWAEVTGDLAAGWPEALTPAAGAVTG
HQEFALSAAETRTLLTESHWAYDTTMNDLLLTATGYALRSVTGRAAHHVTVEGHGRERFA
GAPEVRDTVGWFTTMHPLTVTADPDDIAGSVLATKAAGRRVPHHGIGYGALFGRYGGDRA
PLPPVSFNYLGRVSGAAPRARTGWQLDPALCGADVSGRDRGADRSALDVTMWCADGRLVT
AVDSRLDPAVTERFTTELRSWLERLTAHTSTVAGEEAPARRTGPLTAPEDGFDPYILIDD
GQAERTLFVFPPGEGGAESYLSNIAQRLPGYRLVLFNNVHLHTPMESFEALARYHLDHIR
RLQPSGSYSFLGWSFGGVLAVEVSLQLARAGEKIDNLFLIDPYFDVRHASARIGLPADED
ILDPINYHYTPDPADLERLGARVGSLVLFKAGEVNDVVRDDRQRRLFAFYQRSSCNGLDA
LLPAGSIEVRPLPGATHHSWVRDERLVAGICERVAASLSDAWSARR
NT seq 11121 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagcacggtacccgaggaccgcggcggactggactgcccgcatcgaaggagtc
tccggtgagcgctgcgacctggagatgctgctcaaggacgagtggcgcaacaggatcgcg
gtgcgcgacgacgaccccggtgtccgggccacccggcggcgggagttggcgatcggcggc
cccgtccaccaggcgctgcgccgggcgtcgggcgacggggtgtcggtggcggcgttcgcg
ctggccacgctgcacagcgtgatgcgcgcgtacgggcacggcaaccgcacggtggcggcg
ctggtcgacgccaccggcacggacgacatgcggcgggcccgggtgcttccggtgatcgtg
gaccacgaggcgcagggccggctcagccgtgcggcggcggtacgggagatcgacgcggag
ctgcggcaccgggacgcctggacggcccccgacgcgctgttgcagcggggcctgttcgac
atgctgctggtgctcgccgaccgggagatcccgccggccgaactgccgtcggccccgctc
gccgtgatcgtccgggacgccgcggacgaggggtgtctgcggtggacgatggcctacgcg
ggcgagctgttcgaggaccggacgatcgccggggtgctcgacgtggtccgcgaggtgttc
ggccagtacgtcaccgggcccgcggaaccggtggccggcatcgagctggcatcggcggag
caacgcgagcggctgcgcgagtggaacgccaccgacggcgacttcccggcggacgtgcgc
ctggaggacctgttcacgcgggccgcccggcgctccccggaccagcaggccgtggtcttc
ggcgacaccacgctgacgtaccggacggtggacgagcggtccgaccggctcgcgcggtgg
ctgatcggccccgaggtgggggtggcgccgcaggagctgatcgggctgtacctcgacaag
agcgacctgggggtggtcgccaccctcgggatctggaaggcgggcgccgcctacgtgccg
atcgacccggcgtacccggccgaacgggtccggttcaccgtcggcgacaccggtctcacc
gccgtcgtcaccaaccgccaccacgcggagcggctgcgggagatcctcggcgaccgccat
gccggcgtccgcgtcatcgagatcgagaccgtcctcgcccgctccgccgccgacccgtcc
ccgggcgacctgccgcggccggaggtgagcagccgccacctcgcctacgtcacgtacacc
tccggcaccaccggggtgcccaagggggtgcccaagtaccacgacagcgtggtgaacagc
atcacggacctgtccgagcggtacgacatgcggcggcccggtgaggagcgggtggcgctc
ttcgcctcctacgtcttcgaaccgcatctgcggcagaccctgatcgcgctgatcaactcg
cagacgctggtgatcgtgccggaggacgtccgcctcgaccccgaccggttccccgcgtac
atcgagcgccaccgggtgacgtacctcaacgccaccgggtcggtgctccaccacttcgac
ctgcggcgctgtaccagcctgaagaaactgctgctggtcggcgaggagctgacggcggcc
gggctgaggcggttgcgggagacgttctccgggcggatcgtcaacgagtacgccttcacc
gaggcggcgttcgtcacggcggtgaaggagttcgcgccgggggtgacggagcggccggac
cgcagcatcggccggccggtgcgcaacgtgaagtggtacgtgctgagccagaacctcaag
cagttgccgatcggtgccatcggggagctgtacatcggcggctgcggggtggccccgggc
tatctcaaccgggacgagctgacggcggagcggttcctcgccaacccgtaccagtcggag
cgggacaaggcacgcggcatgaacgcccggctctaccgcaccggtgacctggcccggatg
ctgccctcgggcgaagtggagttcatggggcgcggcgacttccagctgaagctcaacggg
gtgcgggtggagccgggcgagatcgaggcgcgggcgaccgagtacccgggggtgcgcagg
tgtgtcgtggtggcccgggaggggaccgccggcaccggggagcgccatctggtcgggtac
tacgtgaccgagccggcggcggaggtgaccgaggaggagttgctggccttcctggagcag
cggctgatccgcatcatggtcccggcccgcatggtgcggatggacgcgatcccggtcaac
gtcaacggcaaggccgactggcgtgcgctgcccgaggtggacctggcccggccgggcggc
gcggcggcggacgggggtgcggccggtggtgtcctcggccggctgcgggagatctggagc
gcggttctgggggtgccggccgggcggatcggcgacggcgacgacttcttccggctcggc
ggccagtccatctcgtgcatcctgctggtggcccgcatccggcggcagctgggggtcttc
gtcggcgtcgaggacgtcttcgagctgaggaccctggagaagctggcacaccacctggag
cggcgggaacgccacacccccgcgccggatcccggcccggacgccgtaccggagccggcc
gacggcgagcccgtccggctgctcgccggcggcctccagcaggggctgctctaccacgcc
ctcaagcgcaggcacggcgacgacgcctacgtcatgcagtcggtgcaccgctaccactgc
cgtatcgacccggagctgatgcgtgaggcatggcagcacgcccgccgcaagtaccccgcg
ctgcggctgcgtttcgagtgggacggcgaaccgctccaggtcgtcgacaacgacgacaag
ccgttcgactggcggtacgtcgacctgagcgggacggccgaccccggcgaacaggacgcc
cgcatccgggggttgcaggagcgcgaccgcaccgagccgtacgaccccggtgccgggcgg
ctgttccgggtgtacctgatcaagcagcgtgccgacctgttctcgctgatcctcagctgc
caccacatcatcctggacgggtggagcctgccggtgctccacgacgacgtgcaccggatg
tacctgcggctgctgcggggcgaggagatcgagccggcggtggacggcgcgtacctggcg
gcgcagcggcactgggcggcgcgccgcggtgaccacgtcgggtactggacgcgccaggtg
gagcgtatcgacgaacgcggtgacttcgccgggctggtcaaggaggacatccggtaccag
gtcgcgctgggcgagtacgaccacgtgcgggagcaccgcacgcgcaggctggcgctcggc
gcggagaccaccgccgcgctcaaggcggtgtgcgccgcccaccaggtcaccttgcactcg
gtgctccagttcgtctggcaccaggtgctgcatgccatcggcggtggcaacaccacggtg
gtgggcaccatcgtctccgggcgcgacccgcacgtcgacggcatcgagaactcggtgggc
ctgttcatcaacaccctgccgctgatcgtcgaccacgacgaccaggagaccgggagcgtg
gccgacgcgctcggcggtatccaggccgcggtgaacaccatgaacgccaggtgcacggtg
gagctggggcggctggagaccggcgggatgaagcggcggctcttcgacacgctgctggtc
ctggagaactatccgcggctgctcgccgaggacgaggagcgggcccaccgcgaactgctc
cgctacgagaaggcgtacgacgccgacaaggtcgactaccccctggcggtcgtcgcgcgg
gaggaggacgacgagctgacggtcaccttgtggtacgcgggcgagctgttcgacgacacc
accgtcgagacgctgctggacgtggcgcgtaccctgttcgtccaggtcgccgaggacgtc
acgcgtccggtggcggaactggagctggtcccggccgcgatgatcgggcgcttcgacgcc
tggaaccgcacccgggccgcgttcccggccgaccggaccctgcacgggatcttcgaggag
atggcggcggcctggccggacgagaccgccgtggtgtaccgcgacacctcactgacgtac
cgtcagctcaacgagcgggccaaccggctcgcgcaccacctgctctccgtcgcccggctg
cgccccggcgacctcgtcggcctggtcctcgacaagagcgaactgatgatcaccgcgatc
ctggcggtgtggaagaccggcgccgcctacgtgccggtcgacccgggctaccccgacgac
cggatctccttcatgctccaggacaccagcgcccgcctggtggtcaccaaccacgtccac
ggcgaccggctgcgcgcgctgccggacaccgacgggctgccggtgctggacgtcgaacgg
ctgccgctggacgagcacccggcgcacgacccggtcaccgcagtcaccgccaccgacctc
gcctacgccatctacacctccggcaccaccggccggcccaaggcggtgctcgtcgaacac
cagggtgtcgtcaacctccaggtgtccctggcgaagatcttcggactggacaagggcgcc
ggcgacgaggcgctgctgtcgttctccaactacgtcttcgaccacttcgtcgagcagatg
accgacgccctgctcaacggccagaagctggtggtgctcgacgacacgatgcgcaccgac
gccgagcggctgtacaagtacatcaacgaccacgacgtcacctacctgtccggcacgccg
tcggtgctgtcgctctacgactggtccaccaccacctcgctgacccgcatcgacgcgatc
ggcgaggacttcaccgagccggtgttcaacaagatccgcggaacgttccccggcacgatc
atcaacgggtacgggcccaccgagatctccatcaccagccacaagcggccgtacgcgccc
ggtgagcggcggtccaccaagagcatcggccatccggtggccaacaccacggcctacgtg
ctcgacaggcacctgcggcgggtgccggtcggcggcatgggcgagctgtacatcggcggc
gtcggcgtcacccgcggctacctcaaccgcgacgagctgaccgccgaacgcttcatcgcc
aacccgttccagaccccgcgggagaaggcggcggggtacaacgcacggctgtaccgcacc
ggcgacctggtgcggtggcttccgggcggcgagctggagtgcctgggccgcaccgacctc
caggtcaagatccgcggtcagcgcgtcgaactcggcgaggtggaggcggcgttgtcctcc
taccccggggtgacccgggcgctggtggtcgcccgcgaacaccacgcggcggggttcacc
gcgccgcagaagtacctcgtcggcttctacgtctgcgaccgcgacctggacgagcacgag
gtcaagcagtggatgcggggcaaactgcccgaggcggtggtgccctcacgggtgctgcgg
atcaccgacatcccggtgacccccagcggcaagctggacacccggcgcctgccggagacg
gacttcgcctccggtgacggcgtggcgtacgtggcgccctccgacgacgtcgaggcgagg
ctgtgcggcatctggtccaccgtgctcggcgtaccggcggaacgggtcggcgtccgtgac
gacttcttcgcgctcggcggcgacagcctgcgcgcgatggtgctcgcccaggccgtcacc
accgccttcgggcgtggactgggggtcgccaccgtcctccagcacaccacgctcggcgcc
caggcccggcacatccggcaggccgcggcccgcgccgacgacgaagacctccgcccggcg
gccggcaccggccgggtgccggtgtcgccggcccaggaacgcctgctgttcatcgacgag
ttcgagggcggcaccgccgcgtacaacatcccgttcgcgctgcggatcgccaccggtgac
accgatcggatcacccgcgcgctgcacaccctgctgcgccgccaccccgcgctgcgcacg
ctgctgcgcaccgacgaggacggcgtccgccgccagcacgtgatgccggccgaggaggcg
tccgccgggttcgacgtgccggtgcgcaccgtcgacggcgaggcggaactggacgagcgg
ctcgtcgaaggctccggacacgtcttccggcccgccgaggaactgccggtgcgggcggag
ctgttccggctcgccggggcacgggagagcacgtatctgggcctggtgttccaccacacc
tgtttcgacgggtggtcgtggaacaccttccgcgaggagctggcggccctgctgcgcggg
gtgccggagacacagctgccaccggtccggggcacgtacgcggagttcgcggtgtggcag
cggcagcatctgaccggatcgcggacggccgagctgacggagttctggaccggggccctg
gccgggtacgagacggtccggctgccgctggaccgtccgcgtccggcccggttcgactac
cggggccgggagatcgagttcgccctcgacgagccggtcacgcgggcgctgcgggcgctg
gccgggtcggcccgggtgagcctgtacagcgtgctgctgggtgcgtggtgtctgacgctg
cacgtgtacaccggccaggacgacttcgtggtcggtacgccgtcggccaaccgggggcgg
ccggagttcgaccgtaccgtggggttcttcgccaacctgctcgcgctgcgggtgcgggtg
gagaccggggccacgctggcggagtacgtcagggcggtcggcgccggtgtggtggcggcg
caggtccacggtgagctgccgttcgagcagctggtcaaggagctggatccgcgcaaggac
cccagccggcaccccgtgctccaggtcaacttcacgctgcggaaggacgccgggaccacg
gacgaggggtcggcgctgagcgactacacgccggacgccggggggtggacgaccaccaag
ttcgacctgtcggccaccctcaccgagaccgcggaaggcctgaccggcaacctcacgtac
gccgcgtccctcttcgaggacgacagcgcgcacggcttcatcaccaccttccggcacgtc
ctgcgggagttcgcccgcctctcctccggcggcggcgaacagtcccggctgacggaggtc
gggtacgtcgacgtcaccccgccgtccgtcaccggcgcgaccgacggcacgccggtcccg
gcagctcctcgcacgctccacgaggtcttcgcggagacggcggcggtctggccggacagg
acggcggtggtctgcggagacgtggagttgacgtaccgtcagctcgatgagcgggccgac
gcgctggcgcaccagctgcggtccgtggtggcgttgcgcccgggcgagctggtgggtctg
gtgctggacaagagcgagctgatggtcgtcgcgatcctggcggtgtggaaggccggggcg
gcgtacctgccgatcgacccgggctaccccgacgaccggatctccttcatgctccaggac
accggcgcccgtctggtggtcgccaaccacgtccacggcgagcggctgcgtacgctgccc
gcgaccggagggctgccggtgctggacgtcgaacggctgccgctcgacgggcacccggcg
tccgccccggtcaccgaggtcaccgccgccgacccggcctacgcgatctacacctccggc
accaccggccggcccaaggcggtgctggtcccgcaccgggcggtggacagcttccggcgg
cagctgaccggccgctacttcggcggcccggacacctcccgcgagggcgtgctcttcctg
gccaactacgtcttcgacttctccgtcgagcagttggcgctgtcggtgctggccggccac
gcactcgtcgttcccccggtctcccccgccgacgacgacggtttcgccgactacgccaac
cgggccggggtgacgtacctgagcggtacgcccacccagatccagcagctcgacctggcg
cggctgaccgggctgcgctgcgtgctggtcgccggggaggcgttccacgagcgccacttc
gccaagatccgcgcggagttctccgggccgatagtcaacgcctacgggaccacggagacg
gccgtgtacaacacggtccggcgcttcgagcccggtgagccctaccggaacagcctcggc
gcaccgctcggcaacacccggctgtacgtgctcggcgcaggcatgcgtccgctgcccccg
ggggccgtcggtgagctgtacctggccggtgagtgcgtcaccgacggatacctcaaccgg
ccggaactcacccgggaacggtttcttcccaacccgctgcgcaccgaggccgagcgcgcg
gccggccggtacccggtggtctaccgcaccggtgacctggtacggctgacccgggacggc
gagctgcggtacgtggggcgcaacgacgcgcaggtcaagatccacggagtgcgggtcgag
cccggcgaggtggagtcggtgctggccggctgcccggggatcggcgagtgcgccgtcgtc
gccgcgccggacgaacgctcaccggacggcaggcggctggtcgcctactacgtggcggag
cccggcgcggccgtggacgaggacgcggtcttcaccgcgctgcgggcccggctgatggcg
gccatggtgccgtcgctgctggtccggctggacgggccgctgccgatgaccgtcaacggc
aagctggacgccaaggcgctgccggctccgtccgggtcggcgcggcgcgcggcgtacgcg
cccccgcgcagccgtaccgaggcccggctgtgccggttgtggggcgaccacctgcccggt
gacacggtcggcatcgacgacgacttcttccggtcgggcggtgacagcatcagcgccctg
cacctggccggccggatgcagcgtgaactgggccgccgggtcggggtcaaggacatcttc
gacttccccaccgtccggcggctggccgacaacgtcctggccgcgccggaggacgggccc
ggcaccggggacgccggggaggcggcgccggaggcacggccggtcggcgaggccccgctg
ctcccggtccaggagtggttcttcgccaaaccgctgacggaccgcgcctggtggaaccag
accttcgcggtccgcgtcccgccgctcgacgtggccaggctgcgggaggcggtgacgcgg
ctgatcggccaccacgacgcgttccgcctgcggtacaccacgtccggcacccaggtcacc
cagtcctaccaggcggacgatccacggaccgtcctccacgagctggacgtcagcggcctg
ggcgacgaggagatccggcggcggctcgcgcgctggcagagcggcttcgacctggcgcac
ggcccgttgcacagcgtggcctatctgcacggcttccccgacggcggcgcccgggtctgg
ttcgccctgcaccacctgatcgtggacaccgtcagctggcacatcctcgcgcaggacctg
gaaatcctgtaccacggcggccggttggaggagaagaccagcagctaccggcagtgggcc
gaggcgctgcgccgttacgtcgccgaggaggacgagcggcggatgtgggcggaggtgacc
ggggatctcgccgcggggtggcccgaggcgctgaccccggcggccggtgcggtgaccggg
catcaggagttcgcgttgagcgccgcggagacccggaccctgctcaccgagagccactgg
gcgtacgacaccaccatgaacgacctgttgctgacggcgaccggttacgcgctgcggtcg
gtcaccgggcgggcggcccaccacgtcacggtggaggggcacggccgtgagcggttcgcg
ggggccccggaggtgcgggacaccgtcggatggttcaccacgatgcatccgctgaccgtg
acggccgaccccgacgacatcgccggcagcgtcctcgccaccaaggcggccggccggcgg
gtgccgcaccacggcatcgggtacggcgccctgttcggccggtacggcggtgaccgggca
ccgctgccgccggtctccttcaactacctgggccgggtctccggcgcggcaccgcgggca
cggacgggctggcagctcgaccccgcgctgtgcggtgccgacgtctccggacgcgaccgg
ggcgccgaccggtccgcgctcgacgtgacgatgtggtgtgccgacggccgcctggtcacc
gcggtcgacagccgcctggacccggccgtcaccgagcggttcaccaccgaactgcggtcg
tggctggagcggttgaccgcccacacctcgaccgtggccggcgaggaggcaccggcccgg
cggaccggcccgctcaccgcccccgaggacggcttcgacccgtacatcctcatcgacgac
gggcaggccgaacggacgctgttcgtcttcccgcccggcgaggggggcgccgagagctat
ctgagcaacatcgcccagcggctgcccggttaccggctggtgctcttcaacaacgtgcac
ctgcacaccccgatggagtccttcgaggcgctggcccggtaccacctcgaccacatccgg
cgactccagccgtccggctcctacagcttcctcggctggagcttcggcggggtgctcgcg
gtggaggtctcgctccaactggcgcgggccggggagaagatcgacaacctgttcctcatc
gacccgtacttcgacgtgcgccacgcgtcggcccgcatcgggctccccgccgacgaggac
atcctcgacccgatcaactaccactacacccccgacccggccgacctggaacggctcggc
gcccgcgtcggcagcctggtgctgttcaaggcgggtgaggtcaacgacgtcgtccgcgac
gaccggcagcgccggctgttcgcgttctaccagcggtcgtcctgcaacgggctggacgcc
ctgctgccggccggatcgatcgaggtccgtccgctgcccggcgccacccaccactcgtgg
gtacgggacgagcgtctggtggccggcatctgcgaacgggtcgccgcgtcgctgtcggac
gcctggtcggcgcggcgatga

DBGET integrated database retrieval system