KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p02480Help
Entry
SCATT_p02480      CDS       T02095                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCATT_p02480
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCATT_p02480
  Amino acid metabolism
   00310 Lysine degradation
    SCATT_p02480
Enzymes [BR:scy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCATT_p02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCATT:complement(234988..236094)
Genome map
AA seq 368 aa AA seqDB search
MADIRVPKLNNNDTGYQLVAWLVDEDEPVKPDQPVAEVETSKAVEELVSGAEGVLRRLLA
VGDACAPGEVIARVVEPGAPREEPPARPNAVTEAAAEDPGPVVTAPARELMDQLGIDPAR
LRELDVKIVKRADVERLAPEQDSADTRQLPVPQQAVARTVSRSHAEIPAAYTVIAVDAGP
AKAEVARQTTALGRLLGLPELLIAAVARLHAAHPLCFARLTGEHTVRIEERPHIGVTIDV
GKGLNVPVVKDADQLSFAELVEVTTAFRRTAVRGRFRESELSGATIGVTLHNAPDIVHAI
PMIFPGQTCALALSGVRPEVVPDGDGFRARDTVNLGLAYDHRVVNGKDAVDFLQDLKAAL
EHPEELTR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacatccgcgtgcccaaactcaacaacaacgacaccggctaccagctggtggcc
tggctggtcgacgaggacgagccggtcaagcccgaccagccggtggccgaggtggagacc
tccaaggccgtcgaggagctggtgagcggggccgagggcgtcctgcgcagactactcgcg
gtgggtgacgcctgcgcgccgggggaggtcatcgcgcgggtggtcgagcccggcgccccg
cgcgaggagcccccggcacggccgaacgccgtcaccgaggccgccgccgaggaccccggg
ccggtggtcaccgccccggcccgggagctgatggaccaactcggcatcgacccggcccgg
ctgcgcgaactggacgtgaagatcgtcaagcgcgcggacgtcgaacggctcgcccccgaa
caggacagcgccgacacacgccaactgcccgtcccccagcaggcggtggcccgcaccgtg
agccgctcgcacgcggagatcccggccgcctacaccgtcatcgccgtcgacgccggcccg
gccaaggccgaggtggcccggcagaccaccgcgctcggccggctgctgggcctgcccgag
ctgctgatcgcggccgtcgcccggctgcacgccgcgcacccgctgtgcttcgcccggctg
accggcgaacacacggtgcggatcgaggaacggccgcacatcggcgtcaccatcgacgtc
ggcaagggactcaacgtcccggtggtcaaggacgccgaccaactctccttcgccgaactc
gtcgaggtgacgaccgcgttccggcgcaccgcggtgcgcggccggttccgcgagtcggag
ctgtccggcgccaccatcggcgtcaccctgcacaacgcccccgacatcgtgcacgcgatc
cccatgatcttccccgggcagacctgcgcgctggcgctgtccggcgtccggcccgaggtg
gtcccggacggtgacgggttccgcgcccgcgacaccgtcaacctcggactcgcctacgac
caccgggtcgtcaacggcaaggacgcggtggacttcctccaggacctcaaggcggccctg
gagcacccggaggaactcacccgctga

DBGET integrated database retrieval system