KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_p08600Help
Entry
SCATT_p08600      CDS       T02095                                 

Definition
(GenBank) threonine synthase-like protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
scy00260  Glycine, serine and threonine metabolism
scy00750  Vitamin B6 metabolism
scy01100  Metabolic pathways
scy01110  Biosynthesis of secondary metabolites
scy01120  Microbial metabolism in diverse environments
scy01230  Biosynthesis of amino acids
Module
scy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCATT_p08600
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCATT_p08600
Enzymes [BR:scy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCATT_p08600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Imm21
Motif
Other DBs
NCBI-ProteinID: AEW99053
UniProt: F8JNH8
Position
pSCATT:complement(848561..849817)
Genome map
AA seq 418 aa AA seqDB search
MESSPREPEAVPYHPARSLATGQRSLGDPSVRYPLWPPLTAGCPRTADGDTVYPLEVEYD
YAAVPEDLFRRPAGPGLERWAPLLPPLAAPGLGEGNTPLVPIGGGVHVKDESRNPTWSHK
DRLNRVAVSAAKESGAPGVVVASSGNHGAAAAAYAARAGLRCAVFTSPHTPPAVASFVRA
YGATVVTVEREWLRPLVRRVVEEFGYHPVSSVTDTAHTGHPFGPEGYKTIAYEIFRDLGR
VPAAVYVPTGYGELLFGVWKGFHELTLLGRADRVPRLYACEPAAGGPLGAALRAGRPAAQ
VPVGPTGAYGIACPVGGYRGVVAVRRSDGAALAVTDAQLTAARAELAAQGMWVELSSAAG
LAGLRARRASGAAAEDGDGPVVCVATSSGFKDLATGTGTYPATTPEWPAVRELLRQGA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtcgcccagggaacccgaagccgtcccgtaccaccccgcgcgttcgctggcg
accgggcagcgttcgctgggggacccatcggtgcgctatccgctgtggccgccgctgacc
gcggggtgcccgcgcacggccgacggggacacggtgtatccgctggaggtcgagtacgac
tacgcggcggtgccggaggacctgttccggcggccggccgggcccgggctggaacggtgg
gcgccgctgctgccaccgctggccgcgccggggctcggcgagggcaacaccccgctggtg
ccgatcggcggcggcgtccacgtcaaggacgagtcgcgcaacccgacgtggagccacaag
gaccggctgaaccgggtcgcggtgagcgccgccaaggagtccggggcgccgggggtggtg
gtggcctcctccggcaaccacggcgccgcggcggcggcctacgcggcgcgcgccgggctg
cgctgcgcggtcttcacctccccgcacaccccgcccgcggtcgcctcgttcgtccgggcc
tacggcgccaccgtggtcaccgtggagcgcgagtggctgcggcccctggtgcgccgggtc
gtcgaggagttcggctaccacccggtgagcagcgtcaccgacaccgcgcacaccggccac
cccttcggcccggaggggtacaagaccatcgcgtacgagatcttccgcgacctcggccgg
gtcccggcggcggtctacgtgccgaccgggtacggggagctgctcttcggcgtctggaag
gggttccacgagctgacgctgctggggcgggccgaccgcgtgccgcggttgtacgcgtgc
gagccggccgcgggcggtccgctgggcgccgcgctgcgcgccggacggcccgccgcccag
gtgccggtgggccccaccggggcgtacggcatcgcctgcccggtcggcggctaccggggg
gtggtcgcggtacgccgcagcgacggcgcggcgctggccgtcaccgacgcccaactgacc
gccgcgcgcgccgagttggcggcgcaggggatgtgggtggagctctcctcggccgcgggc
ctggccggactgcgcgcccggcgggcgtcgggcgcggcggcggaggacggggacggcccg
gtggtctgcgtggccacctccagcggcttcaaggacctggccaccggcaccgggacgtac
ccggcgaccaccccggagtggccggccgtgcgggagctgctgcgccagggggcctga

DBGET integrated database retrieval system